glyA

Glycosyltransferase GlyA

696 amino acids

Involved in the polymorphic O-glycosylation of the serine-rich repeat protein PsrP. Catalyzes the fourth step in glycosylation of PsrP in this bacteria. Can transfer the sugar from UDP-galactose to the terminal sugar moiety of PsrP-GlcNAc-Glc-Gal or of PsrP-GlcNAc-Glc-Glc (using truncated substrates with the PsrP SSR1 domain) (PubMed:28246170). Has hydrolytic activity against UDP-galactose and to a lesser extent against UDP-glucose (PubMed:28246170).

In the central section; belongs to the glycosyltransferase 8 family.

81.336 kDa

MLVDDKITVIVPVYNVENYLRKCLDSIITQTYKNIEIVVVNDGSTDASGEICKEFSEMDHRILYIEQENAGLSAARNTGLNNMSGNYVTFVDSDDWIEQDYVETLYKKIVEYQADIAVGNYYSFNESEGMFYFHILGDSYYEKVYDNVSIFENLYETQEMKSFALISAWGKLYKARLFEQLRFDIGKLGEDGYLNQKVYLLSEKVIYLNKSLYAYRIRKGSLSRVWTEKWMHALVDAMSERITLLANMGYPLEKHLAVYRQMLEVSLANGQASGLSDTATYKEFEMKQRLLNQLSRQEESEKKAIVLAANYGYVDQVLTTIKSICYHNRSIRFYLIHSDFPNEWIKQLNKRLEKFDSEIINCRVTSEQISCYKSDISYTVFLRYFIADFVQEDKALYLDCDLVVTKNLDDLFATDLQDYPLAAVRDFGGRAYFGQEIFNAGVLLVNNAFWKKENMTQKLIDVTNEWHDKVDQADQSILNMLFEHKWLELDFDYNHIVIHKQFADYQLPEGQDYPAIIHYLSHRKPWKDLAAQTYREVWWYYHGLEWTELGQNHHLHPLQRSHIYPIKEPFTCLIYTASDHIEQIETLVQSLPDIQFKIAARVIVSDRLAQMTIYPNVTIFNGIHYLVDVDNELVETSQVLLDINHGEKTEEILDQFANLGKPILSFENTKTYEVGQEAYAVDQVQAMIEKLREISK

glyA

Serine hydroxymethyltransferase

574 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

62.689 kDa

MNNSALRAYLSTRAPDQIHSAFVAYLANLDLVAHQFPQIASDIVQELIDQRSYVKLIASENYSSLAVQAAMANLLTDKYAEGFPHHRYYGGCQNVDSIESAAAAEACALFGAEHAYVQPHSGADANLVAFWAILSRQIEMPTLSSLGVTAATHLSEEQWEVLRQKMGNQKLMGLDYFSGGHLTHGYRQNVSGRMFRVVSYAVDRDTGLLDYAAIEAQAKRERPLILLAGYSAYPRSINFRIFREIADKVGAVLMADMAHFAGLVAGGVFTGDEDPVRWSHIVTSTTHKTLRGPRGAFILCKKEFAEAVDKGCPLVLGGPLPHVMAAKAVAFREARNAAFKTYAHAVRDNARALADACIQQGMQLQTGGTDNHLLLLDVRPFGLTGRQAERALIDCGVTLNRNSLPFDPNGAWLTSGLRIGTPAVTSLGMGPEEMKRIARLIARVLGAATPVRTKTGALSKSAAEVPGEVRSSVCSEVRELLARFTLYPELDEPFLRAHFTRRPAGQNTCRRRDLNPYGVTPTDFESVVSASFTTSARAQPITRGTKGTAVHVVFLREAPCLPLREPLFFSHEEF

glyA

Serine hydroxymethyltransferase

497 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

54.259 kDa

MVSLLHKFLENASGKKGQDLASTAYLAALDHLLHSFPSIGKSIIDELKSQRSRLKMIASENYASISVQLAMGNLLTDKYCEGSPFKRFYSCCENVDAIEWECVETAKELFGAESAFVQPHSGADANLLAIMAIITQKIQGPAVKRLGYKTINDLTDKEYTELKAEIGSHVCLGPSLNSGGHLTHGTVRLNIMSKLMRCVPYEVNKKTECFDYSEIARLVRTYKPTVLIAGYSSYSRRLNFSTLKQIADDCGAVLWVDMAHFAGLVAGGVFIEEENPIPFADIITTTTHKTLRGPRGGLVLASKEYDAVINRACPLMMGGPLPHVIAAKAVALKEALTVDFKKYAHQVVDNARTLAEHFQKQGLRLLTGGTDNHMLIIDLTSLGISGRIAEDILSSVGIAVNRNTIPSDAVGKWDTSGIRLGTPALTTLGMGSDEMEEVANIIVKVLRNITLRRNADDSFSKSEGELPENIAEEARARVAGLLSRFPLYPEIDLETLV

glyA

Serine hydroxymethyltransferase

497 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

54.205 kDa

MASLLHKFLENASGKKGQDLASTAYLAALDHLLHSFPSIGKSVIDELKGQRSRLKMIASENYASISVQLAMGNLLTDKYCEGSPFKRFYSCCENVDAIEWECAETAKELFGAESAFVQPHSGADANLLAMMAIITQKIQGPAVKRLGYKTINDLTDKEYAELKAEIGSHVCLGPSLNSGGHLTHGTVRMNVMSKLMRCLPYEVNKKTERFDYAEIARLVRTHKPTVLVAGYSSYSRRLNFSTLKQIADDCGAVLWVDMAHFAGLVAGGVFVEEENPIPFADIVTTTTHKTLRGPRGGLVLASKEYDGIINRACPLMMGGPLPHVIAAKAVALKEALTVDFKKYAHQVVDNARTLAEHFQKQGLRLLTGGTDNHMLIIDLTSLGISGRIAEDILSSIGIAVNRNTIPSDAVGKWDTSGIRLGTPALTTLGMGSDEMEEVANIIVKVLRNITLRRNADDSFSKSEGELPENIAQEARARVADLLSRFPLYPEIDLETLV

glyA

Serine hydroxymethyltransferase

497 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

54.268 kDa

MASLLHKFLENASGKKGQDLASTAYLAALDHLLHSFPSIGKSVIDELKSQRSRLKMIASENYSSISVQLAMGNLLTDKYCEGSPFKRFYSCCENVDAIEWECAETAKELFGAESAFVQPHSGADANLLAIMAIITQKIQGPAVKRLGYKTINDLTDKEYAELKAEIGSHVCLGPSLNSGGHLTHGNVRLNVMSKLMRCLPYEVSKKTELFDYAEIARLVRTHKPTVLIAGYSSYSRRLNFSILKQIADDCGAVLWVDMAHFAGLVAGGVFVEEENPIPFADIVTTTTHKTLRGPRGGLMLSTKEYEGMINRACPLMMGGPLPHVIAAKAIALKEALTVDFKKYAHQVVDNARTLAEHFQKHGLRLLTGGTDNHMLIIDLTSLGIPGNVAEDILSSVGIAVNRNTIPSDSEGVWRTSGIRLGTPALTSLGMGSDEMEEVANIIVKVLRNITLRRNADDNFSKSEGELPENIAQEAKARVADLLARFPLYPEIDLETLV

glyA

Serine hydroxymethyltransferase

497 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

54.232 kDa

MTSLLDKYLRNISGKGQQSLASVAYLAALDHLLHSFPSIGQSIVQELKSQRSRLKMIASENFSSLSVQLAMGNLLTDKYCEGSPFKRFYSCCENVDAIEWECVETAKELFGAESACVQPHSGADANLLAIMSIITQKIQSPAVQRLGYKTINDLPEQEYEALKAEMSQYKCLGPSLNSGGHLTHGTVRINVMSKLMHCLPYEVNLDTELFDYDVIAKIAKEHRPTVLIAGYSSYSRRLNFATLKQIAEDCGAVLWVDMAHFAGLVAGGVFIGEENPIPYADIVTTTTHKTLRGPRGGLVLAKKEYSDTLNKACPLMMGGPLPHVIAAKAVALKEAMTINFRKYAHQVVENARTLAEIFQRNGLRLLTGGTDNHMLIIDLTSLGVPGRIAEDMLTSVGIAVNRNSIPSDASGQWKTSGIRLGTPALTTLGMGSAEMEEVANIIAKVLRNITVRRNAEGSSSKSEGVLSEEIAQEARQRVADLLGRFPLYPEIDLETLV

glyA

Serine hydroxymethyltransferase

497 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

54.263 kDa

MVSLLHKFLENASGKKGQSLASTAYLAALDHLLNAFPSIGERIIDELKSQRSHLKMIASENYSSLSVQLAMGNLLTDKYCEGSPFKRFYSCCENVDAIEWECVETAKELFAADCACVQPHSGADANLLAVMAILTHKVQGPAVSKLGYKTVNELTEEEYTLLKAEMSSCVCLGPSLNSGGHLTHGNVRLNVMSKLMRCFPYDVNPDTECFDYAEISRLAKEYKPKVLIAGYSSYSRRLNFAVLKQIAEDCGSVLWVDMAHFAGLVAGGVFVDEENPIPYADIVTTTTHKTLRGPRGGLVLATREYESTLNKACPLMMGGPLPHVIAAKTVALKEALSVDFKKYAHQVVNNARRLAERFLSHGLRLLTGGTDNHMMVIDLGSLGISGKIAEDILSSVGIAVNRNSLPSDAIGKWDTSGIRLGTPALTTLGMGIDEMEEVADIIVKVLRNIRLSCHVEGSSKKNKGELPEAIAQEARDRVRNLLLRFPLYPEIDLEALV

glyA

Serine hydroxymethyltransferase

497 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

54.249 kDa

MASLLDRYLRNISDKSQQNLASVAYLASLDHLLHAFPSIGQSIVQELKSQRSRLKMIASENFSSLSVQLAMGNLLTDKYCEGSPFKRFYSCCENVDAIEWECAETAKELFGAESAFVQPHSGADANLLAIMSIITQKIQSPAVQQLGYKTINDLPEQEYEALKAEMAQHKCLGPSLNSGGHLTHGTVRMNIMSKLMHCLPYEVNLDTELFDYDEIAKIAKEHKPTVLIAGYSSYSRRFNFATLKQIAEDCGAVLWVDMAHFAGLVAGGVFVGEENPMPYADIVTTTTHKTLRGPRGGLVLAKKEYANTLNKACPLMMGGPLPHVIAAKAIALKEAMTINFRKYAHKVVENAQTLAEVFQRNGLRLLTGGTDNHMLIIDLTSLGVPGRIAEDMLTSVGIAVNRNTIPSDASGQWKTSGIRLGTPALTTLGMGSAEMEEVANIIVKVLRNITVRSNAESGSSKSEGELSEGIAQEARQRVADLLGRFPLYPEIDLETLV

glyA

Serine hydroxymethyltransferase

497 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

54.271 kDa

MASLLDRYLRNISDKSQQNLASVAYLASLDHLLHAFPSIGQSIVQELKSQRSRLKMIASENFSSLSVQLAMGNLLTDKYCEGSPFKRFYSCCENVDAIEWECAETAKELFGAESAFVQPHSGADANLLAIMSIITQKIQSPAVQRLGYKTINDLPEQEYEALKAEMAQHKCLGPSLNSGGHLTHGTVRMNIMSKLMHCLPYEVNLDTELFDYDEIAKIAKEHKPTVLIAGYSSYSRRLNFATLKQIAEDCGAVLWVDMAHFAGLVAGGVFVGEENPMPYADIVTTTTHKTLRGPRGGLVLAKKEYANTLNKACPLMMGGPLPHVIAAKAIALKEAMTINFRKYAHKVVENARTLAEVFQRNGLRLLTGGTDNHMLIIDLTSLGVPGRIAEDMLTSVGIAVNRNTIPSDASGQWKTSGIRLGTPALTTLGMGSAEMEEVANIIVKVLRNITVRSNAESGSSKSEGELSEGIAQEARQRVADLLGRFPLYPEIDLETLV

glyA

Serine hydroxymethyltransferase

497 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

54.249 kDa

MASLLDRYLRNISDKSQQNLASVAYLASLDHLLHAFPSIGQSIVQELKSQRSRLKMIASENFSSLSVQLAMGNLLTDKYCEGSPFKRFYSCCENVDAIEWECAETAKELFGAESAFVQPHSGADANLLAIMSIITQKIQSPAVQQLGYKTINDLPEQEYEALKAEMAQHKCLGPSLNSGGHLTHGTVRMNIMSKLMHCLPYEVNLDTELFDYDEIAKIAKEHKPTVLIAGYSSYSRRFNFATLKQIAEDCGAVLWVDMAHFAGLVAGGVFVGEENPMPYADIVTTTTHKTLRGPRGGLVLAKKEYANTLNKACPLMMGGPLPHVIAAKAIALKEAMTINFRKYAHKVVENAQTLAEVFQRNGLRLLTGGTDNHMLIIDLTSLGVPGRIAEDMLTSVGIAVNRNTIPSDASGQWKTSGIRLGTPALTTLGMGSAEMEEVANIIVKVLRNITVRSNAESGSSKSEGELSEGIAQEARQRVADLLGRFPLYPEIDLETLV

glyA

Serine hydroxymethyltransferase

497 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

54.271 kDa

MASLLDRYLRNISDKSQQNLASVAYLASLDHLLHAFPSIGQSIVQELKSQRSRLKMIASENFSSLSVQLAMGNLLTDKYCEGSPFKRFYSCCENVDAIEWECAETAKELFGAESAFVQPHSGADANLLAIMSIITQKIQSPAVQRLGYKTINDLPEQEYEALKAEMAQHKCLGPSLNSGGHLTHGTVRMNIMSKLMHCLPYEVNLDTELFDYDEIAKIAKEHKPTVLIAGYSSYSRRLNFATLKQIAEDCGAVLWVDMAHFAGLVAGGVFVGEENPMPYADIVTTTTHKTLRGPRGGLVLAKKEYANTLNKACPLMMGGPLPHVIAAKAIALKEAMTINFRKYAHKVVENARTLAEVFQRNGLRLLTGGTDNHMLIIDLTSLGVPGRIAEDMLTSVGIAVNRNTIPSDASGQWKTSGIRLGTPALTTLGMGSAEMEEVANIIVKVLRNITVRSNAESGSSKSEGELSEGIAQEARQRVADLLGRFPLYPEIDLETLV

glyA

Serine hydroxymethyltransferase

491 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

52.936 kDa

MSDPRAVDPTARDIAEKLAPAYRTMLDAIAQVEPRIAEATRAELTDQRHSLKLIASENYASLPVLATMGTWFSDKYAEGTAGHRFYAGCQNVDTVETIAAEHACALFGAEHAYVQPHSGIDANLTAYWTILAHHIETPALSEFGARTVNDLTQVDWDTLRHRFNDQRAIGMSLDAGGHLTHGFRPNISGKMFDQRSYGTDPQTGLLDYDKVAELAREFKPLVIVAGYSAYPRRVNFAKMREIADEVGAVLMVDMAHFAGLVAGKVFTGDENPIPHAQVVTTTTHKSLRGPRGGMVLTTKDYADDVDRGCPMVLGGPLSHVMAAKAVALAEARTQTFRDYAQRVANNAKALAEGLMKRGVKLVTDGTDNHINLLDVTTSFGLTGRQAEAALLDAGVVTNRNSIPTDPNGAWYTSGIRIGTPALTSRGFGPDEFDQVAELIVTTLEATTPMTASTGKPGKAKYQIADGVAQKVHDAADELLGNFPLYPGLDLA

glyA

Serine hydroxymethyltransferase

490 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

51.904 kDa

MAADPSSNSSSVPAANGADYADTASAAYQAALQVIESVEPRVAAATRKELADQRDSLKLIASENYASPAVLLTMGTWFSDKYAEGTIGHRFYAGCQNVDTVESVAAEHARELFGAPYAYVQPHSGIDANLVAFWAILATRVEAPELANFGAKHINDLSEADWETLRNKLGNQRLLGMSLDAGGHLTHGFRPNISGKMFHQRSYGTNPETGFLDYDAVAAAAREFKPLVLVAGYSAYPRRVNFAKMREIADEVGATLMVDMAHFAGLVAGKVFTGDEDPVPHAHVTTTTTHKSLRGPRGGMVLATEEYAPAVDKGCPMVLGGPLSHVMAAKAVALAEARQPAFQQYAQQVADNAQALADGFVKRDAGLVTGGTDNHIVLLDVTSFGLTGRQAESALLDAGIVTNRNSIPADPNGAWYTSGVRLGTPALTSRGFGADDFDRVAELIVEVLANTQPEGTSKAKYKLADGTAERVHAASSELLSANPLYPGLTL

glyA

Serine hydroxymethyltransferase

490 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

51.904 kDa

MAADPSSNSSSVPAANGADYADTASAAYQAALQVIESVEPRVAAATRKELADQRDSLKLIASENYASPAVLLTMGTWFSDKYAEGTIGHRFYAGCQNVDTVESVAAEHARELFGAPYAYVQPHSGIDANLVAFWAILATRVEAPELANFGAKHINDLSEADWETLRNKLGNQRLLGMSLDAGGHLTHGFRPNISGKMFHQRSYGTNPETGFLDYDAVAAAAREFKPLVLVAGYSAYPRRVNFAKMREIADEVGATLMVDMAHFAGLVAGKVFTGDEDPVPHAHVTTTTTHKSLRGPRGGMVLATEEYAPAVDKGCPMVLGGPLSHVMAAKAVALAEARQPAFQQYAQQVADNAQALADGFVKRDAGLVTGGTDNHIVLLDVTSFGLTGRQAESALLDAGIVTNRNSIPADPNGAWYTSGVRLGTPALTSRGFGADDFDRVAELIVEVLANTQPEGTSKAKYKLADGTAERVHAASSELLSANPLYPGLTL

glyA

Serine hydroxymethyltransferase

478 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

51.274 kDa

MSRNAESTAYRSALEVISAVEPRVADAIRSELTDQRESLKLIASENYASPATLLAMGNWFSDKYAEGTIGRRFYAGCQNVDTIEALAAEHARELFGATHAYVQPHSGIDANLVAFWAVLADRVESPTLERARARHVNDLTEADWFALRRELGNQRMLGMSLDAGGHLTHGFRPNISGKMFDQRSYGTDPETGLIDYDQVAEAAREFRPLILVAGYSAYPRKVNFRIMREIADSVGATFMVDMAHFAGLVAGKVFTGDFDPVPHAHIVTSTTHKSLRGPRGGLVLCGPELAEQVDRGCPMVLGGPLPHVMAAKAVALAEARRPDFADYAERIVANAQALADGLLRRGAKLVTGGTDNHLALIDVTGYGLTGRQAEQALLDSGIVTNRNAVPQDPNGAWYTSGIRVGTPALTTRGLGTAELEATAELIHTVLSLTSPGANADGTPSKAKYVLDPAVADRVNKQASELLAGFPLYPAIDLG

glyA

Serine hydroxymethyltransferase

478 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

50.917 kDa

MSGNAESTAYRSALEVIGAVEPRVANAIRAELTDQRESLKLIASENYASPATLLAMGNWFSDKYAEGTVGRRFYAGCQNVDTVEALAAEHARELFGAPYAYVQPHSGIDANLVAFWAVLADRIESPALRRAQARHVNDLTEADWFALRRELGNQRMLGMSLDAGGHLTHGFRPNISGKMFDQRSYGTDPETGLIDYDGVAEAAREFKPLILLGGYSAYPRKVNFRILREIADSVGATFMVDMAHFAGLVAGKAFTGDFDPVPHAHIVTSTTHKSLRGPRGGLVLCGPELAEQVDRGCPMVLGGPLPQVMAAKAVALAEARRPDFVDYAGRIVANAQALADGLQRRGAQLVTGGTDNHLALIDVTGYGLTGRQAEHALLDSGIVTNRNAIPQDPNGAWYTSGIRVGTPALTTRGLGTAELDATAELIHTVLSHTAPGTNADGTSSKAKYVLDPAVADRVGKQASDLLTGFPLYPAIDLG

glyA

Serine hydroxymethyltransferase

441 amino acids

Catalyzes the reversible interconversion of serine and glycine with a modified folate serving as the one-carbon carrier. Also exhibits a pteridine-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

48.091 kDa

MAGASTSRKSYGRIFTLLRDHNKWFENSIPLIASENIPSPAVREALISDFGNRYAEGWPGERVYAGCTYIDMVETECMKLAKKLFKAEFADVRPVSGVVANLAIYSAFSDPGDVMIAPSIPAGGHISHGRKEHSGTAGLVHGLEVEFYPFDAKSMTIDVDATKAKIIDLEKAGRTPKIAMFGGSLFLFPHPVKELAEFMKGRGMHINYDGAHVAGLIAGGQFQDPIREGADTMTMSTHKTLFGPQGGLVLGRNEHAEGIKKAMFPGLTSSHHIHHMAAKAVAFTEALEFGKKYAKDVVRNAKALAESLSGLGFKVLGEDGGFTKSHQVAVNVLEYSDGGKIEARLEKANIIVNRQLIPGDIKAGRHYLHPGGIRLGVSEVTRLGMGTGEMAEIAELMKQAVTERGDPKRLASKVKSFRKPFQKVQYCFDKKLPAYEYVKLR

glyA

Serine hydroxymethyltransferase

441 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

48.029 kDa

MDTDILKMQDREVFEAIALETGRQMETLELIASENFTSRAVMQACGSVMTNKYAEGYPGKRYYGGCEFVDIAENLARDRAKKLFGCEYVNVQPHSGSSANMAVLFSVLKPGDCIMGLDLSHGGHLTHGSSVNFSGQMYKAHAYGVDGETGIIDMNQVEKMALEVRPRLIICGASAYSQGFDFKAFREIADKVGAFLMADIAHPAGLIVSGLLSDPMPHCHFVTTTTHKTLRGPRGGMIMMGKDFENPMGITIKTKNGQRVKMMSEVMDAEVMPGIQGGPLMHIIAGKAVAFGEALRPEFRQYAMQVRSNAAAMSERFLSLGYNIVSGGTKNHLMLLDLRNKDITGKVVENTLHEAGITVNKNMVPFDDKSPFVTSGIRIGTAAMTTRGMNEDDSRLIAELIDRVILSAASPESSSVCRSVKEEIRSLCLRNPLEGYGVTPS

glyA

Serine hydroxymethyltransferase

440 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

46.646 kDa

MSASAKPAAKSAATASAPDSFFSATIADADPEIAAAIAGELGRQRHEIELIASENIVSRAVMEAQGSVMTNKYAEGYPGHRYYGGCEFVDVAENLAIERAKKLFGAGFANVQPNSGSQMNQAVFLALLQPGDTFMGLDLAAGGHLTHGSSVNMSGKWFKPVHYGVRREDGIIDMDEVAKIAEANKPKLIIAGGSAYSRAWDFKRFREIADSVGAYFMVDMAHFAGLVAGGVHANPVPHAHVVTTTTHKSLRGPRGGLILTNDEALAKKFNSAIFPGLQGGPLMHVIAAKAVAFKEALQPDFKVYAKNVVENAKALAETLRGHGFDIVSGGTDNHLMLVDLRPKSLKGNVSEKALVRAGITCNKNGIPYDPEKPFVTSGIRLGTPAATTRGFGVAEFQQVGGMIAEVLNAIAQSEDGTAPLVEAAVKARVKELTDRFPIYQ

glyA

Serine hydroxymethyltransferase

440 amino acids

Catalyzes the reversible interconversion of serine and glycine with a modified folate serving as the one-carbon carrier. Also exhibits a pteridine-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

48.723 kDa

MAKSQNKESYNKIFAKLKEHHKWFENSIPLIASENIPSPAVREAVISDFGNRYAEGWPGERVYAGCIYIDDVEFECMKLAKKLYKAKFADVRPISGVVANLAVYSAYSNPGDVMLAPSIPAGGHISHGKKEHSGTAGLVHGLEIEFYPFDAEEMTIDVDKTKQKVKELKKNNRLPKIAMFGGSLFLFPHPVKELSDFLKSYDMHINYDAAHVAGLIAGGKFQDPLKEGADTMTMSTHKTLFGPQGGLVLGSEKHEEPIKKATFPGLTSSHHINNMAGKAVAFAEALEFGKDYAAQVIKNAKSFAEALSDAGFKVLGESRGFTQSHQIAVNVLDYSDGGKVEADLEKANIIVNRQLIPGDIKAGRNYFHPGGIRLGVSEITRLGMKKNEMQEIASFIKQVVIEKKDPKKLLSKVKSFRKNYQKVKFCFDNKLGAYEYVKLR

glyA

Serine hydroxymethyltransferase

440 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

47.415 kDa

MSIEILQKQDKEIFDAISNEVLRQTETLELIASENFASKAVMEACGSVMTNKYAEGYPGKRYYGGCEFVDVAEDLARERAKKLFGCQYVNVQPHSGSSANMGVLFSVLKPGDTIMGLDLSHGGHLTHGSSVNFSGQLFDAHSYGVDRETGLIDMDRVEDMALSVRPRLIICGASAYSQGFDFKAFRQIADKVGAFLMADIAHPAGLIAAGLLNDPMPHCHFVTTTTHKTLRGPRGGMIMMGEDFENPMGITIKTKAGRRTKMMSEVIDAEIMPGIQGGPLMHIIAAKAVAFGEALQPEFKEYAVQVRANAAAMAQKFISLDYNIVSGGTKNHLMLIDLRNKNVTGKVAENLLHEAGITVNKNMVPFDDKSPFVTSGIRIGTPAMTTRGMTESHAEAIVSLIDRVIGAAGSPDAGTVCGEVRSEIKAMCGTLPLNDFSPTL

glyA

Serine hydroxymethyltransferase

440 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

47.546 kDa

MDTDILRMQDKEVFEAIAGETLRQTETLELIASENFTSRAVMQACGSLMTNKYAEGYPGKRYYGGCEFVDIAENLARDRAKKLFGCQYVNVQPHSGSSANMAVLFSVLKPGDRIMGLDLSHGGHLTHGSPVNFSGQLFDAHSYGVDRETGCIDMNRVEELALEVRPKLIICGASAYSQGFDFKAFREIADKVGALLMADIAHPAGLIAAGLLSDPMPHCHFVTTTTHKTLRGPRGGMIMMGSDFENPLGITIKTKTGSRVKMMSEVMDAEVMPGIQGGPLMHIIAGKAVAFGEALQPAFREYAVQVRKNAAAMAESFAGLGYNIVSGGTKNHLMLLDLRNKEVNGKVAENLLHEAGITVNKNMVPFDDKSPFVTSGIRIGTAAMTTRGMTENDSRTVAGLIDQVISSANSAGVEEICRTVRHDIRELCLAYPLEGYGVNP

glyA

Serine hydroxymethyltransferase

440 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

47.799 kDa

MDTDILKMQDREVFDAIAGETVRQMETLELIASENFTSRAVMQACGSVMTNKYAEGYPGKRYYGGCEFVDIAEDLARERARKLFGCEYVNVQPHSGSSANMAVLFSVLKPGDRIMGLDLSHGGHLTHGSSVNFSGQMFDARSYGVDRETGIIDMNKVEEMALDFKPRLIICGASAYSQGFDFKAFREIADKVGAFLMADIAHPAGLIAAGLLTDPMPHCHFVTTTTHKTLRGPRGGMIMMGKDFENPMGITIKTKNGPRVKMMSEVMDAEVMPGIQGGPLMHIIAGKAVAFGEALRPEFREYAVQVRKNAASMAERFTSLGYNIVSGGTKNHLMLLDLRNKDVNGKVAENLLHDAGITVNKNMVPFDDKSPFVTSGIRIGTAAMTTRGMKEADATLIAELIDRVITGAAESTIAATCKDVKAEIRSLCLQNPLEGYGVTP

glyA

Serine hydroxymethyltransferase

440 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

47.616 kDa

MDYELLKRLDPEVFEAIANETRRQTETLELIASENFTSTAVMEACGSVMTNKYAEGYPGKRYYGGCEFVDVAENLARDRAKKLFGCEYVNVQPHSGSSANMAVLFAVLKPGDSIMGLDLSHGGHLTHGSKVNFSGQFFDAHSYGVDKETGIIDMNAVEEMALKVKPKLIITGASAYSQGFDFKAFREIADKVGAFLMADIAHPAGLVAAGLSANPVPHCHFVTTTTHKTLRGPRGGMIMMGKDFENPMGITVNTKNGPRVKMMSEVIDAEVMPGIQGGPLMHIIAGKAVAFGEALQPEFKAYAQQIKDNAAAMAAKFLAADYHIVSGGTKNHLMLLDLRNKNVNGKVAENLLHDAGITVNKNMVPFDDKSPFVTSGIRVGTPAMTTRGMKVAEAEKIVEFIDRVISAANDDNVADVCKQVRAEVRELCLQFPLNGYGLQV

glyA

Serine hydroxymethyltransferase

440 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

48.141 kDa

MDTDILQMQDKEVFEAVVNETVRQTETLELIASENFTSRAVMQACGSVMTNKYAEGYPGKRYYGGCEFVDVAENLARDRAKKLFNCSYVNVQPHSGSSANMAVLFSVLKPGDRIMGLDLSHGGHLTHGSPVNFSGQLYEAHSYGVRRETGCIDMNMVEELANKVRPKLIICGASAYSQGFDFKAFREIADRIGALLMADIAHPAGLIVAGLLSDPVPHCHFVTTTTHKTLRGPRGGMIMMGSDFENPLGITIKTKTGSRVKMMTEVMDAEVMPGIQGGPLMHIIAGKAVAFAEALRPEFRDYALQVKKNAAVMADKFSSLGYTIVSGGTKNHLMLLDLRNKNVNGKVAENLLHQAGITVNKNMVPFDDKSPFVTSGIRIGTPAMTTRGMKESDSERIVELIDRVVSAAETPAVDDVCRLVRQEIRELCLQHPMDGYEMTP

glyA

Serine hydroxymethyltransferase

440 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

48.3 kDa

MHLDILKNADPEVYAAIQSELERQTDTLELIASENFTSRAVMEACGSVMTNKYAEGYPGKRFYGGCEFVDVAEDLARDRAKKLFSCEYANVQPHSGSSANMAVIFTFCKPGDTILGFDLSHGGHLTHGSPVNFSGQFYNAHFYGVEKETGRIDMNRVEEKAKEVKPKLIICGASAYSRDWEYAEFRRIADSVDAILMADIAHPAGLIATGLLNDPMPHCHVVTTTTHKTLRGPRGGMILMGKDFENPMGIKAKTKTGERIKMVSELLDAMVMPGIQGGPLMHVIAGKAVAFGEALNPEYKQYMEQVRKNAAAMAEQFISLGYDIISGGTDNHLMLIDLRNKDITGKKTENLLHEAGITVNKNMVPFDDKSPFVTSGFRVGAAAMTTREMKEAEAKTIVKFIDKVISNAGSENISAICQEVKEEVNALCQQFPLYDFVPAS

glyA

Serine hydroxymethyltransferase

440 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

47.448 kDa

MDNDILKRLDPEVFEAIANETKRQTETLELIASENFTSKAVMEACGSVMTNKYAEGYPGKRYYGGCEFVDVAENLARDRAKKLFGCEYVNVQPHSGSSANMAVLFAVLKPGDAIMGLDLSHGGHLTHGSKVNFSGQFFDAHSYGVDKETGIIDMNKVEEMARRVKPKLIITGASAYSQGFDFKAFREVADKVGALLMADIAHPAGLVAAGLSANPMPHCHFVTTTTHKTLRGPRGGMIMMGKDFENPLGLTINTKNGSRVKMMSEVIDAEVMPGIQGGPLMHIIAGKAVAFGEALQPEFKAYAQQIKDNAAAMAAKFLAAGYHIVSGGTKNHLMLLDLRNKNVNGKVAENLLHEAGITVNKNMVPFDDKSPFVTSGIRIGTPAMTTRGMKVAEAEKIVEFIDRVISAANDANVADVCKAVRAEVRELCLGFPLNNYGSLV

glyA

Serine hydroxymethyltransferase

439 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

47.045 kDa

MNAPHRDETTASHRDDGFFTESLESRDPEIFAASQKELGRQRDEIELIASENIVSAAVMEAQGGVMTNKYAEGYPGRRYYGGCQYVDIAEELAIDRAKQLFGCDFANVQPNSGSQANQGVFTALLQPGDTILGMSLDAGGHLTHGARPNQSGKWFNAVQYGVREGDLEIDYDQIAALAAEHKPKMIIAGGSAIPRIIDFARMREIADTIGAYLLVDMAHFAGMVASGHYPSPFPHAHVATTTTHKTLRGPRGGMIVTNDEAIAKKVNSAIFPGIQGGPLMHVIAGKAVAFGEALRPEFRDYQTQVIANAQALAAQLIKGGLDIVTGGTDTHLMLVDLRAKGVKGNATEKALGRAHITCNKNGIPFDTEKPMVTSGLRLGSPAGTTRGFGEAEFRQIADWIVEVVDGLAANGEDANDAVEAKVRGEVQALCDRFPIYPNL

glyA

Serine hydroxymethyltransferase

439 amino acids

Catalyzes the reversible interconversion of serine and glycine with a modified folate serving as the one-carbon carrier. Also exhibits a pteridine-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism (By similarity).

Belongs to the SHMT family.

48.607 kDa

MKELDLSDPLSMVLKIAELTTRHNVWRLRESINLIASENVMSLTALKAYLSDFMFRYAEGKPFKRYYQGTRYIDELEVLTGELMGSMMGTNLVELRPVSGTIANASVFRVLAEPGDKAVIAPVQAGAHVSHTKFGTLGALGIEQVSMPYDEENMNVDVDKAVKLIEEVKPRFAVLGGSVYIFPHPTREIAEAIHSVGGKLIYDAAHVLGLIMGGAWPNPLERGADAVTGSTHKTFPGPQGGAVFFRDEQLYKKVSKTIFPWWVSNHHLHRIPATAITAVEMKLYGRDYASQVTSNARKLAEALAAEGLKVIGEHLGYTRSHQVVVDVRDLGGGAKCASLLEESNIIVNKNLLPWDPPEAVKDPSGIRIGVQEVTRLGMKHGEMEEIAKLIRKVLIDKEDPKKVAEQVKEFRKQFMKIHYSLDDKDVRIDTIADILSLAQ

glyA

Serine hydroxymethyltransferase

439 amino acids

Catalyzes the reversible interconversion of serine and glycine with a modified folate serving as the one-carbon carrier. Also exhibits a pteridine-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

49.466 kDa

MVIDITKKYPELKEIYELTVNHTIWRKKECINLIASENVMSPLAMLLYLNDMMHRYAEGKPFKRFYQGLKFVDELEVKAQRIIGELLETDYVELRPISGTIANATVFKAFAEHGDKAVVVPVQAGAHVSHTRYGTLGGLGIEQVEMPFNIEEWNIDVDGAKKVIEKVKPKIVILGGSLYIFPHPVKEIAEAAHSVGAKLMYDVAHVLGLITGKVWENPLKQGADILTSSTHKTFPGPQGGLIATVTKDDYKKVSKIVFPVFVSNHHLHRLAALAVTGLEMKYFGRQYAEQIVKNAKAFAEALAENGFKVIGENKGYTESHQVIIDVREHGGGAKNAKLLEEANIIVNKNMLPWDKPEDIKNPSGIRLGVQEVTRWGMKEEDMKTIAEFMRLVVIDKRDPKEIRNKVIEFRKNFLEIHYGFKISGEEETKLLKIMLHGEV

glyA

Serine hydroxymethyltransferase

439 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

47.231 kDa

MSQANAAAKNASSDVFFNASLEDIDSEIFGAIRNELGRQRHEIELIASENIVSRAVLEAQGSILTNKYAEGYPGKRYYGGCQYVDVVEELAIERAKKLFGCEFANVQPNSGSQMNQAVFLALLQPGDTFMGLDLNSGGHLTHGSPVNMSGKWFNVVSYGVRKDDHLLDMDEVARLARENKPKLILAGGTAYSRVWDWKRFREIADEVGAYLMVDMAHIAGLVAGGVHPSPVPHAHVCTTTTHKSLRGPRGGMILTNDADIAKKINSAVFPGLQGGPLMHVIAGKAVAFAEALKPEFKLYAKNVVDNARALAEELKSNGLDIVSGGTDNHLMLVDLRPKNATGKRAEAALGRANITCNKNGIPFDPEKPFVTSGVRLGTPAGTTRGFGVTEFKEIGSLIAEVLDGLKVANSDEGNAAVEQAVKEKVMALTDRFPMYGYQG

glyA

Serine hydroxymethyltransferase

439 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

47.691 kDa

MNMDILQRQDKGIFDAITAEVRRQTETLELIASENFASRAVMEACGSVMTNKYAEGYPGKRYYGGCEFVDIAENLARDRAKKLFGCDYVNVQPHSGSSANMGVLFAVLKPGDRIMGLDLSHGGHLTHGSKVNFSGQLFEAHSYGVDRETGCIDMNKVEEMALEVRPKLIICGASAYSQGFDFKAFRDVADKVGAFLMADIAHPAGLIAAGLLNDPMPHCHFVTTTTHKTLRGPRGGMIMMGKDFENPLGITVKTKKGSRTKMMSEVIDAEIMPGIQGGPLMHIIAAKGVAFGEALQPEFKDYAVQVRNNAAVMAERFSGLDYQIVSGGTKNHLMLIDLRNKNVTGKVAENLLHDAGITVNKNMVPFDDKSPFVTSGIRIGTPAMTTRGMQESHAENIVGFIDRVISAADSEGIEKVCAEVRSDVKAMCKDLPLNDFGPE

glyA

Serine hydroxymethyltransferase

438 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

46.339 kDa

MSSNPAATLSDVQPDGFFTRGLADADPAVFGGLTEEIAREKKQIELIASENIVSKAVLEAQGSVFTNKYAEGYPGKRYYQGCHPSDVVEQLAIDRAKQLFNCGFANVQPHSGAQANGAVMLALTQPGDTIMGLSLDAGGHLTHGAKAALSGKWYKAVQYGVRPDDHRIDFDQVEALAREHKPKLIITGGSAYPRHIDFARFRAIADEVGALFMVDMAHFAGLVAGGVHPTPFGHAHVVTTTTHKTLRGPRGGMIMTDDEAIAKKINSAVFPGLQGGPLMHVVAAKAVAFGEALRPEFKAYAAAVVENAKVLAARLKERGADLVSGGTDTHLALVDLRPIGVTGRDADEALERAGITCNKNGVPNDPLPPVKTSGIRVGSPAGTTRGFGPAEFREIADMIADVLDGLAKNGPEGNGQTEAHVKARVEALCDRFPIYPEL

glyA

Serine hydroxymethyltransferase

438 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydromethanopterin (H4MPT) serving as the one-carbon carrier. Also exhibits a pteridine-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

48.917 kDa

MRDVHGSLKYFSSVAEDMNPSDVFQIIEGHTKLMRDSIPLIASENLTSLSVRRCYVSDLGHRYAEGRVGERFYEGCKYVDQIESMAIELTRKIFEAEHANVQPISGVVANLAAFFALTNVGDTIMSISVPCGGHISHDRVSAAGLRGLRVIHYPFNSEEMSVDVDETRKVAERERPKLFILGSSLILFRQPVKEIREIADEIGAYVMYDASHVLGLIAGKAFQNPLKEGADVMTGSTHKTFFGPQRAIIASRKELAEKVDRAVFPGVVSNHHLNTLAGYVVAAMEMLEFGEDYAKQVVRNAKALAEELYSLGYKVLGEKRGFTETHQVAVDVREFGGGERVAKVLENAGIILNKNLLPWDSLEKTANPSGIRIGVQEVTRIGMKEEEMRAIAEIMDAAIKEKKSVDELRNEVKELKERFNVIKYSFDESEAYHFPDLR

glyA

Serine hydroxymethyltransferase

438 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydromethanopterin (H4MPT) serving as the one-carbon carrier. Also exhibits a pteridine-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

48.917 kDa

MRDVHGSLKYFSSVAEDMNPSDVFQIIEGHTKLMRDSIPLIASENLTSLSVRRCYVSDLGHRYAEGRVGERFYEGCKYVDQIESMAIELTRKIFEAEHANVQPISGVVANLAAFFALTNVGDTIMSISVPCGGHISHDRVSAAGLRGLRVIHYPFNSEEMSVDVDETRKVAERERPKLFILGSSLILFRQPVKEIREIADEIGAYVMYDASHVLGLIAGKAFQNPLKEGADVMTGSTHKTFFGPQRAIIASRKELAEKVDRAVFPGVVSNHHLNTLAGYVVAAMEMLEFGEDYAKQVVRNAKALAEELYSLGYKVLGEKRGFTETHQVAVDVREFGGGERVAKVLENAGIILNKNLLPWDSLEKTANPSGIRIGVQEVTRIGMKEEEMRAIAEIMDAAIKEKKSVDELRNEVKELKERFNVIKYSFDESEAYHFPDLR

glyA

Serine hydroxymethyltransferase

438 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

47.414 kDa

MDTDILQKQDAEVFASIANETKRQTETLELIASENFTSRAVMQACGSVMTNKYAEGYPGKRYYGGCEFVDVAENLARDRAKKLFGCEYVNVQPHSGSSANMAVLFSVLKPGDKIMGLDLSHGGHLTHGSSVNFSGQMFEAHSYGVDRETGCIDMNKVEEMAMQVRPKLIIGGASAYSQGFDFKAFRAIADKVGALLMADIAHPAGLIAAGLLPNPLQHCHFVTTTTHKTLRGPRGGMIMMGSDFENPLGITIKTKTGSRVKMMSEVMDAEVMPGIQGGPLMHIIAGKAVAFGEALQPAFKEYAAQVMKNASTMASRFMELGYTIVSGGTKNHLMLLDLRNKNVTGKEAENLLHEAGITVNKNMVPFDDKSPFVTSGIRIGTPAMTTRGMKEAESRRIAELIDQVITSASKPDISAICEAVREEIKTICHNNPIEGYSV

glyA

Serine hydroxymethyltransferase

438 amino acids

Catalyzes the reversible interconversion of serine and glycine with a modified folate serving as the one-carbon carrier. Also exhibits a pteridine-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

49.032 kDa

MLRFWQEKLPLLPQELREVLEKTITHNLWRKYETINLIASENAMSPLALAAYVSDMMHRYAEGKPFKRYYQGTRYVDEIEHRVMQLMGELLGGAHVDPRPVSGTTANASAFRALTNCGDKAVVAPVQAGAHVSHTKFGTLGGLCIEHIEMPYDPENMNIDVDKAIRLIEEVRPRLVVLGGSVYLFPHPVKEIADTAHSVGAKLVYDAAHVLGLIVGRRWRNPLDHGADVMTASTHKTFPGPQGGIVATRSEELYKTISRVVFPVFVSNHHLHRLPALAVTAVEMKYFGEQYADQVVRNAKALAEALAAEGFKVLGEHLGYTKSHQVLVDVRAQGGGAKAATLLEKANIIVNKNLLPYDPPDAIKDPSGLRLGVQEMTRYGMKEDNMKDIARFMRRVLIDGEDPEKVAREVKEYRKEYLEVKYCFDVNPLEDGRLYLLL

glyA

Serine hydroxymethyltransferase

438 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

47.161 kDa

MSQANAATKAYSDVFFNASLEDIDPEIFGAIRNELGRQRHEIELIASENIVSRAVLEAQGSILTNKYAEGYPGKRYYGGCQYVDVVEELAIERAKKLFGAEFANVQPNSGSQMNQAVFLALLQPGDTFMGLDLNSGGHLTHGSPVNMSGKWFNVVSYGVRKDDHLLDMDEVARLARENKPKLILAGGTAYSRIWDWKRFREIADEVGAYLMVDMAHIAGLVAGGQHPSPVPHAHVCTTTTHKSLRGPRGGMILTNDADIAKKINSAVFPGLQGGPLMHVIAGKAVAFAEALKPEFKLYAKNVVDNARALAEELKSHGLDIVSGGTDNHLMLVDLRPKNATGKRAEAALGRANITCNKNGIPFDPEKPFVTSGVRLGTPAGTTRGFGVAEFKEIGSLIAEVLDGLKVANSDEGNAAVEQAVKEKVIALTGRFPMYGYQG

glyA

Serine hydroxymethyltransferase

438 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

47.161 kDa

MSQANAATKAYSDVFFNASLEDIDPEIFGAIRNELGRQRHEIELIASENIVSRAVLEAQGSILTNKYAEGYPGKRYYGGCQYVDVVEELAIERAKKLFGAEFANVQPNSGSQMNQAVFLALLQPGDTFMGLDLNSGGHLTHGSPVNMSGKWFNVVSYGVRKDDHLLDMDEVARLARENKPKLILAGGTAYSRIWDWKRFREIADEVGAYLMVDMAHIAGLVAGGQHPSPVPHAHVCTTTTHKSLRGPRGGMILTNDADIAKKINSAVFPGLQGGPLMHVIAGKAVAFAEALKPEFKLYAKNVVDNARALAEELKSHGLDIVSGGTDNHLMLVDLRPKNATGKRAEAALGRANITCNKNGIPFDPEKPFVTSGVRLGTPAGTTRGFGVAEFKEIGSLIAEVLDGLKVANSDEGNAAVEQAVKEKVIALTGRFPMYGYQG

glyA

Serine hydroxymethyltransferase

438 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

47.161 kDa

MSQANAATKAYSDVFFNASLEDIDPEIFGAIRNELGRQRHEIELIASENIVSRAVLEAQGSILTNKYAEGYPGKRYYGGCQYVDVVEELAIERAKKLFGAEFANVQPNSGSQMNQAVFLALLQPGDTFMGLDLNSGGHLTHGSPVNMSGKWFNVVSYGVRKDDHLLDMDEVARLARENKPKLILAGGTAYSRIWDWKRFREIADEVGAYLMVDMAHIAGLVAGGQHPSPVPHAHVCTTTTHKSLRGPRGGMILTNDADIAKKINSAVFPGLQGGPLMHVIAGKAVAFAEALKPEFKLYAKNVVDNARALAEELKSHGLDIVSGGTDNHLMLVDLRPKNATGKRAEAALGRANITCNKNGIPFDPEKPFVTSGVRLGTPAGTTRGFGVAEFKEIGSLIAEVLDGLKVANSDEGNAAVEQAVKEKVIALTGRFPMYGYQG

glyA

Serine hydroxymethyltransferase

438 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

47.131 kDa

MSQANAATKASSDVFFNASLEDIDPEIFGAIRNELGRQRHEIELIASENIVSRAVLEAQGSILTNKYAEGYPGKRYYGGCQYVDVVEELAIERAKKLFSAEFANVQPNSGSQMNQAVFLALLQPGDTFMGLDLNSGGHLTHGSPVNMSGKWFNVVSYGVRKDDHLLDMDEVARLARENKPKLILAGGTAYSRIWDWKRFREIADEVGAYLMVDMAHIAGLVAGGQHPSPVPHAHVCTTTTHKSLRGPRGGMILTNDADIAKKINSAVFPGLQGGPLMHVIAGKAVAFAEALKLEFKLYAKNVVDNARALAEELKSHGLDIVSGGTDNHLMLVDLRPKNATGKRAEAALGRANITCNKNGIPFDPEKPFVTSGVRLGTPAGTTRGFGVAEFKEIGSLIAEVLDGLKVANSDEGNAAVEQAVKEKVIALTGRFPMYGYQG

glyA

Serine hydroxymethyltransferase

438 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

47.085 kDa

MSQANAATKASSDVFFNASLEDIDPEIFGAIRNELGRQRHEIELIASENIVSRAVLEAQGSILTNKYAEGYPGKRYYGGCQYVDVVEELAIERAKKLFGAEFANVQPNSGSQMNQAVFLALLQPGDTFMGLDLNSGGHLTHGSPVNMSGKWFNVVSYGVRKDDHLLDMDEVARLARENKPKLILAGGTAYSRIWDWKRFREIADEVGAYLMVDMAHIAGLVAGGQHPSPVPHAHVCTTTTHKSLRGPRGGMILTNDADIAKKINSAVFPGLQGGPLMHVIAGKAVAFAEALKPEFKLYAKNVVDNARALAEELKSHGLDIVSGGTDNHLMLVDLRPKNATGKRAEAALGRANITCNKNGIPFDPEKPFVTSGVRLGTPAGTTRGFGVAEFKEIGSLIAEVLDGLKVANSDEGNAAVEQAVKEKVIALTGRFPMYGYQG

glyA

Serine hydroxymethyltransferase

438 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

46.995 kDa

MSQANAATKASSDVFFNASLEDIDPEIFGAIRNELGRQRHEIELIASENIVSRAVLEAQGSILTNKYAEGYPGKRYYGGCQYVDVVEELAIERAKKLFGAEFANVQPNSGSQMNQAVFLALLQPGDTFMGLDLNSGGHLTHGSPVNMSGKWFNVVSYGVRKDDHLLDMDEVARLARENKPKLILAGGTAYSRIWDWKRFREIADEVGACLMVDMAHIAGLVAGGQHPSPVPHAHVCTTTTHKSLRGPRGGMILTNDADIAKKINSAVFPGLQGGPLMHVIAGKAVAFAEALKPEFKLYAKNVVDNARALAEELKSHGLDIVSGGTDNHLMLVDLRPKNATGKRAEAALGRANITCNKNGIPFDPEKPFVASGVRLGTPAGTTRGFGVAEFKEIGSLIAEVLDGLKVANSDEGNAAVEQAVKEKVIALTGRFPMYGYQG

glyA

Serine hydroxymethyltransferase

438 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

47.097 kDa

MSQANAATKASSDVFFNASLEDIDPEIFGAIRNELGRQRHEIELIASENIVSRAVLEAQGSILTNKYAEGYPGKRYYGGCQYVDVVEELAIERAKKLFGAEFVNVQPNSGSQMNQAVFLALLQPGDTFMGLDLNSGGHLTHGSPVNMSGKWFNVVSYGVRKDDHLLDMDEVARPARENKPKLILAGGTAYSRIWDWKRFREIADEVGAYLMVDMAHIAGLVAGGQHPSPVPHAHVCTTTTHKSLRGPRGGMILTNDADIAKKINSAVFPGLQGGPLMHVIAGKAVAFAEALKPEFKLYAKNVVDNARALAEELKSHGLDIVSGGTDNHLMLVDLRPKNATGKRAEAALGRANITCNKNGIPFDPEKPFVTSGVRLGTPAGTTRGFGVAEFKEIGSLIAEVLDGLKVANSDEGNAAVEQAVKEKVIALTGRFPMYGYQG

glyA

Serine hydroxymethyltransferase

438 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

46.966 kDa

MSQANAATKASSDVFFNASLEDIDPEIFGAIRNELGRQRHEIGLIASENIVSRAVLEAQGSILTNKYAEGYPGKRYYGGGQYVDVVEELAIERAKKLFGAEFANVQPNSGSQMNQAVFLALLQPGDTFMGLDLNSGGHLTHGSPVNMSGKWFNVVSYGVRKDDHLLDMDEVARLARENKPKLILAGGTAYSRIWDWKRFREIADEVGAYLMVDMAHIAGLVAGGQHPSPVPHAHVCTTTTHKSLRGPRGGMILTNDADIAKKINSAVFPGLQGGPLMHVIAGKAVAFAEALKPEFKLYAKNVVDNARALAEELKSHGLDIVSGGTDNHLMLVDLRPKNATGKRAEAALGRANITCNKNGIPFDPEKPFVTSGVRLGTPAGTTRGFGVAEFKEIGSLIAEVLDGLKVANSDEGNAAVEQAVKEKVIALTGRFPMYGYQG

glyA

Serine hydroxymethyltransferase

438 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

47.131 kDa

MSQANAATKASSDVFFNASLEDIDPEIFGAIRNELGRQRHEIELIASENIVSRAVLEAQGSILTNKYAEGYPGKRYYGGCQYVDVVEELAIERAKKLFSAEFANVQPNSGSQMNQAVFLALLQPGDTFMGLDLNSGGHLTHGSPVNMSGKWFNVVSYGVRKDDHLLDMDEVARLARENKPKLILAGGTAYSRIWDWKRFREIADEVGAYLMVDMAHIAGLVAGGQHPSPVPHAHVCTTTTHKSLRGPRGGMILTNDADIAKKINSAVFPGLQGGPLMHVIAGKAVAFAEALKLEFKLYAKNVVDNARALAEELKSHGLDIVSGGTDNHLMLVDLRPKNATGKRAEAALGRANITCNKNGIPFDPEKPFVTSGVRLGTPAGTTRGFGVAEFKEIGSLIAEVLDGLKVANSDEGNAAVEQAVKEKVIALTGRFPMYGYQG

glyA

Serine hydroxymethyltransferase

437 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

47.781 kDa

MTKQGNDTQKRFFNDNLQTVDVAIFDAIRGEFERQQHEIELIASENIVSRAVLEAQGSVLTNKYAEGYPGKRYYGGCQFVDVIENLAIERAKKLFGADFANVQANSGSQMNQAVFLALLKPGDTFMGLDLNSGGHLTHGSSVNMSGKWFKSISYGVRKEDQLLDMEAVERLAKEHKPKLIIAGGSAYSRLWDWKKFREIADEIGAYLLVDMSHIAGLVAGGVHPSPVPHAHIVTTTTHKSLRGPRGGLILTNDEILAKKINSAIFPGLQGGPLMHVIAAKAVAFEEALQPVFKDYSANVVANAKTLAKTLQSNGFDIVSGGTDNHLLLVDLRSKKVTGKCAELALGRAHITCNKNSIPFDLETPFITSGIRLGSPAATTRGFAENEFIEIAHMISEILDNLGMAKSDEDNSAVEMVVRKKVEDMTNKFPLYSYLHTC

glyA

Serine hydroxymethyltransferase

436 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

47.465 kDa

MSMLQTLWRSDPAVARIIDGEMRRQRDGLELIASENYASRAVMEAQGSALTNKYAEGYPGARYYGGCEWVDQVEDLARARVKELFGAEYANVQPHSGSQANMAVYFTFLRPGDKVLGMNLAHGGHLTHGSPVNFSGQLYTFVAYGIDPKTERIDYDQVAEIARRERPKMITVGASAYSRAIDFAIFRQIADEVGAFLFADIAHPAGLIAKGLLPSPIPYAHVVTSTTHKTLRGPRGGIIMMGKDFENPFGLKAAKSGRTLMMSELLDKMVIPGVQGGPLMHVIAAKAVGFGENLQPEFETYARQIIRNAQTLAGALMARGYHILSGGTDNHLMLIDLRNKGVSGKAAQEALDRAAITTNKNAVPNDDKSPLITSGIRLGTPALTTRGMKEPEMEQIAALIDDVITHINDDHTINRVREEVFALCARFPVPGLEPSA

glyA

Serine hydroxymethyltransferase

436 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

47.469 kDa

MSTLQTLWRSDPAVARIIDGEMRRQRDGLELIASENYASRAVMEAQGSALTNKYAEGYPGARYYGGCEWVDQVEDLARERVKELFGAAYANVQPHSGSQANMAVYFTFLRPGDKVLGMNLAHGGHLTHGSPVNFSGQLYTFVAYGIDPKTERIDYEQVAEIAHRERPKMITVGASAYSRAIDYAVFRQIADDVGAFLFADIAHPAGLIAKGLLPSPIKYAHVVTSTTHKTLRGPRGGIILMGEDFENPFGLKAAKSGRTLMMSELLDKMVIPGVQGGPLMHVIAAKAVGFGENLQPEFETYARQVIRNAQTLANALIARGYHVLSGGTDNHLMLIDLRNKAVSGKAAQEALDRAAITTNKNAVPNDDKSPLITSGIRLGTPALTTRGMKEPEMEQIAALIDDVITHINDDHVINRVREEVMALCARFPVPGLEPST

glyA

Serine hydroxymethyltransferase

436 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

46.998 kDa

MTSPQNSSTQNSQQHNTPLAELDPQVAEAIAGELRRQRTTLEMIASENFVPRAVLQAQGSVLTNKYAEGYPGRRYYGGCEHVDVIEDLARDRAKQVFGAEFANVQPHAGAQANAAVLMSLANPGDKIMGLSLAHGGHLTHGMHLNFSGKLYEVAAYEVDPETFRLDMDKIREQAIAEKPQVLIAGWSAYPRHQDFAAFKSIADEVGAKLWVDMAHFAGLVAADLHPSPVPHADVVSTTVHKTLGGPRSGMILAKQEYAKKLNSSVFPGQQGGPLMHAVAAKAVAMKVAQTDEFRDRQQRTLEGAKILAERLNAQDTKDAGVQVLTGGTDVHLVLVDLRNSQLDGQQGEDLLHEVGITVNRNAVPFDPRPPMVTSGLRIGTSALASRGLDTKAFTEVADIIGTALAGNADIAALRARVDKIAADFPLYEGLEDWKLV

glyA

Serine hydroxymethyltransferase

436 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

47.075 kDa

MTTATAAPEIRKAGFFTEHLETADAEVFAAIRGELKRQQTKIELIASENITSLAVLEATGSVFTNKYAEGYPGKRYYGGCEYADVVENLAIERAKKLFGCNFANVQPNSGSQMNQAVFLALLQPGDSFMGLDLNSGGHLTHGSPVNMSGKWFKPIPYGVRADDHLIDMDEVARLARENKPKLIIAGGTAYSRVWDFKRFREIADEVGAWLLVDMSHFSGLVAGGAHPSPFPHAHVVTSTTHKSLRGPRSGIILTNDEDLAKKFNMAVFPGMQGGPLVHVIAAKAVAFGEALRPEFKAYAAQIVANARALAEAVKDAGLSVVSGGTDNHLMLVDLSAKDVTGKAAEKGLDRAWLTCNKNGVPFDKRSPFVTSGIRLGTPAGTTRGFREEEFRKIGALIGEVVDGLARNGEEGDGQVEQRVRDRVAELCAQFPIYPEL

glyA

Serine hydroxymethyltransferase

435 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

46.625 kDa

MPDTQIEAGNESPFFTRSIVESDREVAHAIHEEINRQQNQIELIASENIVSRAVLEAQGSPLTNKYAEGYPGRRYYGGCEYVDVVETLAIERAKALFGAQYANVQPNSGSQANQGVFLALLKPGDTILGMSLDAGGHLTHGARPNMSGKWFKAESYGVRESDARIDYDAVRAKAIEVKPQLIIAGGSAYPREIDFAEFRKIADEVGAYLMVDMAHVAGLVAGGVYPNPMPHAHVCTTTTHKTLRGPRGGMILSNDPDLGKKFNSAIFPGLQGGPLMHVIAGKAVAFGEALQPEFKDYVTRVVANCQALSKAITDGGYAIVSGGTDSHLALVDLRPKGLKGNSAEQALERAFITCNKNGVPFDPEKPTVTSGLRVGSPAATTRGFGVAEFTLVGELMVRVLDALVDQPDGDAEVEAEVREQVKALTARFPIYPELA

glyA

Serine hydroxymethyltransferase

435 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

46.142 kDa

MTTETLDKPIKSAGYFTDGVAIVDPAVAAAMTRELEREQYQIELIASENIVSRAVLEAQGSVFTNKYAEGYPGRRYYQGCAPSDEVEQLAIDRAKQLFDCGYANVQPHSGAQANGAVMLALTKPGATILGMSLDAGGHLTHGAPPAMSGKWFNAVQYGVRADDHLVDFDQVEALAREHRPALIIAGGSAYPRTLDFARFRAIADDVGALLMVDMAHFAGLVAGGAHPSPMQYAHVVTTTTHKTLRGPRGGMILTNDEAIAKRINSAVFPGLQGGPLMHVIAAKAVAFGEALRPEFKDYAKATIANAQALANRLKARGADIVAGGTDTHLALIDLRPLGITGRDADEALERSAITCNKNGVPFDPLPPVKTSGIRVGSPAGTTRGFGIAEFEAIGDMVADVLDALRDKGEHGDADVEADVRGRVRALCERFPIYQG

glyA

Serine hydroxymethyltransferase

435 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

46.422 kDa

MADSAHVPETLAGGFFSVGLAERDPELAAAINQEATRQQHQIELIASENIVSRAVLEAQGSILTNKYAEGYPGKRYYGGCEFVDIAEELAIERAKKLFNCGFANVQPNSGSQANQGVFQAVLKPGDTILGMSLAAGGHLTHGAKPNQSGKWFNAVQYGVRPEDHLIDFDEVERLARAHRPQMIIAGGSAYPRQIDFKRFREIADDVGAIFLVDMAHFAGLVAGGAHPNPLDHCHIATTTTHKTLRGPRGGMILTNDEALAKKINSAIFPGIQGGPLMHVIAGKAVAFGEALMPEFKTYVEQVVSNARAMAAACRTAGLDVVSDGTDTHLALIDLRPKGVTGRDAEAALERAYITCNKNGIPFDPAPPTVTSGIRVGSPAGTTRGFREEEFIQIGTWIGEIVDALANGNSDAVEARVREEVKALTARFPIYEGLGG

glyA

Serine hydroxymethyltransferase

434 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

46.334 kDa

MSAGTATDTTDLDSFFSAHLAETDPEIAKAISQELGRQQHEIELIASENIVSRAVLEAQGSVLTNKYAEGYPGRRYYGGCQFVDIAEELAIDRAKRLFGCGFANVQPNSGSQANQGVFMALMQPGDTFLGLDLAAGGHLTHGAPPNVSGKWFKPVSYTVRREDQRIDMEQVERLAQEHKPKVIIAGGSGYPRHWDFAKFREIADSVGAYFFVDMAHFAGLVAAGLHPSPFPHAHVATTTTHKTLRGPRGGMILTNDEALAKKFNSAIFPGLQGGPLMHVIAAKAVAFGEALKPEFKIYAKQVIDNARALADTIISGGYDITSGGTDNHLMLVDLQKKGLTGKAAEAALSRADITCNKNGVPFDPQKPTITSGIRLGTPASTTRGFGVAEFKQVGSLIVQVLDGIAEKGDGGDAAVEAAVKEKVHALTDRFPIYA

glyA

Serine hydroxymethyltransferase

434 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

46.334 kDa

MSAGTATDTTDLDSFFSAHLAETDPEIAKAISQELGRQQHEIELIASENIVSRAVLEAQGSVLTNKYAEGYPGRRYYGGCQFVDIAEELAIDRAKRLFGCGFANVQPNSGSQANQGVFMALMQPGDTFLGLDLAAGGHLTHGAPPNVSGKWFKPVSYTVRREDQRIDMEQVERLAQEHKPKVIIAGGSGYPRHWDFAKFREIADSVGAYFFVDMAHFAGLVAAGLHPSPFPHAHVATTTTHKTLRGPRGGMILTNDEALAKKFNSAIFPGLQGGPLMHVIAAKAVAFGEALKPEFKIYAKQVIDNARALADTIISGGYDITSGGTDNHLMLVDLQKKGLTGKAAEAALSRADITCNKNGVPFDPQKPTITSGIRLGTPASTTRGFGVAEFKQVGSLIVQVLDGIAEKGDGGDAAVEAAVKEKVHALTDRFPIYA

glyA

Serine hydroxymethyltransferase

434 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

46.334 kDa

MSAGTATDTTDLDSFFSAHLAETDPEIAKAISQELGRQQHEIELIASENIVSRAVLEAQGSVLTNKYAEGYPGRRYYGGCQFVDIAEELAIDRAKRLFGCGFANVQPNSGSQANQGVFMALMQPGDTFLGLDLAAGGHLTHGAPPNVSGKWFKPVSYTVRREDQRIDMEQVERLAQEHKPKVIIAGGSGYPRHWDFAKFREIADSVGAYFFVDMAHFAGLVAAGLHPSPFPHAHVATTTTHKTLRGPRGGMILTNDEALAKKFNSAIFPGLQGGPLMHVIAAKAVAFGEALKPEFKIYAKQVIDNARALADTIISGGYDITSGGTDNHLMLVDLQKKGLTGKAAEAALSRADITCNKNGVPFDPQKPTITSGIRLGTPASTTRGFGVAEFKQVGSLIVQVLDGIAEKGDGGDAAVEAAVKEKVHALTDRFPIYA

glyA

Serine hydroxymethyltransferase

434 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

45.896 kDa

MTAPASNITADKNAFFGADLAAADRDIFDRIGLELNRQQNQIELIASENIVSRAVLEAQGSILTNKYAEGYPGKRYYGGCEYVDEIETIAIERAKALFGAGFANVQPHSGSQANQSVFMALLQPGDTFLGMDLAAGGHLTHGSPANQSGKWFKPVSYTVRQQDQLIDYDAVEEVAQASKPKLIIAGGSAYSRQIDFARFRQIADSVGAYLMVDMAHFAGLVAGGVFPSPIPHAHVVTTTTHKTLRGPRGGMVLTNDEAIIKKVNSAVFPGLQGGPLEHVIAAKAVAFGEALQPAFKAYAQAVIDNARALAEALQTQGVNIVSGGTDSHLMLVDLRPKGVTGRDAEHSLERAHMTCNKNGVPFDTASFAVTSGIRLGTPAGTTRGFGAAEFTRVGQLIGEVVNGLAANGVDGNGAVEAKVREEVLALTARFPIYN

glyA

Serine hydroxymethyltransferase

434 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

46.069 kDa

MSSAPAAGTASTSRFFKSHVSETDPDIFSAIQKEFGRQQHEIELIASENIVSQAVLDAAGSVLTNKYAEGYPGKRYYGGCQYVDIVEDIAIDRAKKLFNCEFANVQPNSGSQANQGVFNALAQPGDTILGLSLAAGGHLTHGAPVNQSGKWFKAVHYMVKPDSHLIDMDEVRKLAQEHKPRIIIAGGSAYPRKIDFAAFRAIADEVGAIFLVDMAHFAGLVAAGLIPSPFPHAHVVTTTTHKTLRGPRGGMILTNDADIAKKINSAIFPGIQGGPLMHVIAGKAVAFGEALRPDFKVYIKQVMDNARALGEVLVQNGFALVSGGTDTHLVLVDLRPKKLTGTKAEKALGRANITCNKNGIPFDPEKPMVTSGIRLGSPAGTTRGFGVAEFQEIGRLISEVLDGVAKNGEDGNGAVEAAVKAKAIALCDRFPIYA

glyA

Serine hydroxymethyltransferase

434 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

46.145 kDa

MTDVLPTTPTASGVTDRPLSEVDPEIAAVLDAELGRQRDTLEMIASENFAPRSVLEAQGSVLTNKYAEGYPGKRYYGGCEHVDVAEELARTRAKELFGAEHANVQPHSGASANAAAMHAFIRGGDGILGLELAHGGHLTHGMKINFSGRMYDVSSYGVDPQTFRVDMDVVRAVALESRPKLIIAGWSAYPRQLDFAAFRSIADEVGAHLMVDMAHFAGLVAAGLHPSPVPHAHVVTSTVHKTLAGPRSGLILTRQEFAKKIDSAVFPGQQGGPLMHVVAAKAVAFKVAGSEEFAERQRRTLEGAKIVAERLTAPDVAEAGVSVLTGGTDVHLVLVDLRDSKLDGQQAEDRLHEVGITVNRNAVPFDPRPPMVTSGLRIGTPALATRGFGAAEFTEVADVIALALKPEFDADALRARVAKLTAEFPLYPSAGSFA

glyA

Serine hydroxymethyltransferase

434 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

46.265 kDa

MTASSAKPASSVDSFFSATLAEADPEIAAAIKGELGRQRHEIELIASENIVSRAVLEAQGSVMTNKYAEGYPGARYYGGCEWVDVAENLAIDRAKKLFGANFANVQPNSGSQMNQAVFLALLQPGDTFMGLDLAAGGHLTHGSPVNMSGKWFKAAHYTVRRDDHLIDMDAVAKQAEEVKPKLIIAGGSAYSRPWDFKRFREIADHVGAYLLVDMAHFAGLVAGGAHASPVPHAHIVTTTTHKSLRGPRGGLILWNDEQFTKKLNSAIFPGLQGGPLMHVIAAKAVAFAEALRPEFKTYAKNIVENAKALAESLRAQGFDIVSGGTDNHLMLVDLRPKGLKGNVSEKALVRAGITCNKNGIPFDPEKPFVTSGLRLGTPAATTRGFGVAEFQQVGSLIAEVLNAIAQAPDGSAPLVEAAVKAKVKALTDRFPIYQ

glyA

Serine hydroxymethyltransferase

434 amino acids

Catalyzes the reversible interconversion of serine and glycine with a modified folate serving as the one-carbon carrier. Also exhibits a pteridine-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

47.777 kDa

MDPVEAYGRVKSSILEHHKWFDSSLPMIASENVTSPAVRKAMTSDFGHRYAEGWVGERVYAGTKYIDEVESIAMELVKRLFNVKFADVRPISGVVANLAVYTAFTNPGDVAMALPITKGGHISMGPLRGSEGQFIGGTAGAVRGLDVKYLAFDDHNMNVDVDKSIKRIEENKPKLVILGGSVILFPHPVKELSDVCKSVGALLHYDAAHVAGLIAGKQFQQPMEEGADVMTMSTHKTFFGPQHGAVITNDEEKFERIKLANFPGLLSNHHLHSVAALALAAAEMLAFGEEYARAVVRNAKALAQALHDEGFSVVAEHLGFTQSHQVLLDVDALGGGHRCEKLLEEANIIVNRNLLPWDIKRGRSFKDPGGLRLGVSELTRLGMGEEEMKEIAKLYRKVLLDREDPKKVAGEVSELRKRFRNVKYAFEEGPAYEY

glyA

Serine hydroxymethyltransferase

434 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

46.56 kDa

MTDAHHADDVRYQPLSEIDPEVAQAIAGELSRQRDTLEMIASENFVPRSVLQAQGSVLTNKYAEGYPGRRYYGGCEQVDIIEDLARDRAKALFDAEFANVQPHSGAQANAAVLMTLADPGDKIMGLSLAHGGHLTHGMKLNFSGKLYEVAAYGVDPDTMLVDMDQVREQAIKEQPKVIIAGWSAYPRHLDFAAFREIADEVGATLWVDMAHFAGLVAAGLHPSPVPYADVVSSTVHKTLGGPRSGIILAKQDYAKKLNSSVFPGQQGGPLMHAIAAKATALKIAGTDQFAERQARTIEGARILAERLTASDAKAAGIDVLTGGTDVHLVLADLRNSEMDGQQAEDLLHEVGITVNRNAVPFDPRPPMVTSGLRIGTPALATRGFDATAFTEVADIIGTALAQGKSADLESLQARVTKLAEQYPLYEGLEDWTIV

glyA

Serine hydroxymethyltransferase

434 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

46.541 kDa

MTDAHQADDVRYQPLNELDPEVAAAIAGELARQRDTLEMIASENFVPRSVLQAQGSVLTNKYAEGYPGRRYYGGCEQVDIIEDLARDRAKALFGAEFANVQPHSGAQANAAVLMTLAEPGDKIMGLSLAHGGHLTHGMKLNFSGKLYEVVAYGVDPETMRVDMDQVREIALKEQPKVIIAGWSAYPRHLDFEAFQSIAAEVGAKLWVDMAHFAGLVAAGLHPSPVPYSDVVSSTVHKTLGGPRSGIILAKQEYAKKLNSSVFPGQQGGPLMHAVAAKATSLKIAGTEQFRDRQARTLEGARILAERLTASDAKAAGVDVLTGGTDVHLVLADLRNSQMDGQQAEDLLHEVGITVNRNAVPFDPRPPMVTSGLRIGTPALATRGFDIPAFTEVADIIGTALANGKSADIESLRGRVAKLAADYPLYEGLEDWTIV

glyA

Serine hydroxymethyltransferase

434 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

46.541 kDa

MTDAHQADDVRYQPLNELDPEVAAAIAGELARQRDTLEMIASENFVPRSVLQAQGSVLTNKYAEGYPGRRYYGGCEQVDIIEDLARDRAKALFGAEFANVQPHSGAQANAAVLMTLAEPGDKIMGLSLAHGGHLTHGMKLNFSGKLYEVVAYGVDPETMRVDMDQVREIALKEQPKVIIAGWSAYPRHLDFEAFQSIAAEVGAKLWVDMAHFAGLVAAGLHPSPVPYSDVVSSTVHKTLGGPRSGIILAKQEYAKKLNSSVFPGQQGGPLMHAVAAKATSLKIAGTEQFRDRQARTLEGARILAERLTASDAKAAGVDVLTGGTDVHLVLADLRNSQMDGQQAEDLLHEVGITVNRNAVPFDPRPPMVTSGLRIGTPALATRGFDIPAFTEVADIIGTALANGKSADIESLRGRVAKLAADYPLYEGLEDWTIV

glyA

Serine hydroxymethyltransferase

434 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

46.344 kDa

MSAGTASDTTALNTFFSAQLAETDPEIAKAISQELGRQQHEIELIASENIVSRAVLEAQGSVLTNKYAEGYPGRRYYGGCQFVDIAEELAIDRAKRLFGCGFANVQPNSGSQANQGVFMALMQPGDTFLGLDLAAGGHLTHGAPPNVSGKWFKPVSYTVRREDQRIDMEQVERLAQEHKPKVIIAGGSGYPRHWDFAKFREIADSVGAYFFVDMAHFAGLVAAGLHPSPFPHAHVATTTTHKTLRGPRGGMILTNDEALAKKFNSAIFPGLQGGPLMHVIAAKAVAFGEALKPEFKIYAKQVIDNAKALADTIISGGYDITSGGTDNHLMLVDLQKKGLTGKAAEAALSRADITCNKNGVPFDPQKPTITSGIRLGTPASTTRGFGVAEFKQVGSLIVQVLDGLADKGESGDSTVEAAVKEKVHALTDRFPIYS

glyA

Serine hydroxymethyltransferase

434 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

46.269 kDa

MSAGTAADKHFSNSFFAAPLTEADPEIAEAVAKELGRQQHEIELIASENIVSRAVLEAQGSVLTNKYAEGYPGRRYYGGCQFVDIAEDLAIERAKRLFDCGFANVQPNSGSQANQGVFLALMQPGDTFLGLDLAAGGHLTHGAPPNVSGKWFKPVSYTVRREDQRIDMEQVAQLAQEHKPKVIIAGGSGYPRHWDFAKFREIADSVGAYFMVDMAHFAGLVAAGVHPSPFPHAHVATTTTHKTLRGPRGGMILTNDEALAKKFNSAIFPGLQGGPLMHVIAGKAVAFGEALKPEFKIYARQVVENARALADTLISGGYDITSGGTDNHLMLVDLQRKGLTGKAAEAALSRAHITCNKNGVPFDTQKPTITSGIRLGTPAGTSRGFGVAEFKQIGGFIVEVLDGLAAKGEAGDSAVEADVKTRVHALTDRFPIYG

glyA

Serine hydroxymethyltransferase

434 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

46.659 kDa

MSEHASQSTLNRFFHAPLKEVDAEVATILNEELTRQQDGIELIASENMASFAVMEAQGSVLTNKYAEGLPGKRYYGGCVDVDRVENLAIDRLKKIFGAEFANVQPHSGANANQAAFMALAKPGDTVLGLSLAAGGHLTHGAAPNYSGKWFNSVQYGVRAEDGLIDYDQMEALAREHKPKIIVAGSSAYPRVIDFARFRKIADEVGAYLMVDMAHFAGLVAAGLYPNPVPMADITTSTTHKTLRGPRGGIILTNNPDLAKKVNSAVFPGLQGGPLMHVIAGKAVAFGEALSDEFKAYQKRVLANARALADELQNRGFDIVTGGTDSHLILVDLRPKKVTGKLAEAILERAGITANKNAIPFDPEKPFVTSGIRLGSPAATARGFGEAEFREVGRMIDEVLTAALEEDNAEAVTARVHEEVKALCRRFPIYDRASA

glyA

Serine hydroxymethyltransferase

434 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

46.333 kDa

MNSSAKTASAPDSFFTATLAEADPEIAAAIKGELGRQRHEIELIASENIVSRAVLEAQGSVMTNKYAEGYPGARYYGGCEWVDVAETLAIERAKKLFGAQFANVQPNSGSQMNQAVFLALLQPGDTFMGLDLAAGGHLTHGAPVNMSGKWFKAAHYTVRRDDHLIDMDEVARRAEEVKPKLIIAGGSAYSRPWDFKRFREIADSVGAYLMVDMAHFAGLVAGGVHASPVPHAHVTTTTTHKSLRGPRGGLILCNDEALAKKFNSAIFPGLQGGPLMHVIAAKAVAFGEALRPDFKIYAKNVVENAKALAESLRGNGFDIISGGTDNHLMLVDLRPKGLRGNVSEKALVRAAITCNKNGIPFDPEKPFVTSGLRLGTPAATTRGFGVAEFKQVGGLIAEVLNAIAQADDGKAPLVEAAVKEKVKALTNRFPIYQD

glyA

Serine hydroxymethyltransferase

434 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

46.904 kDa

MTTPRDNLAILAETDPVVYRLIQQELNRQRDHLEMIASENFTSPAVLAAQGSVLTNKYAEGLPGKRYYGGCEFIDEIEQLAIDRAKQLFGAAHANVQPHSGAQANFAVFLALLQPGDTIMGMDLAHGGHLTHGSPVNVSGKWFRVVHYGVDPQTERIDFDQVRDLARQHRPKLIICGYSAYPRIIDFAAFRAIADEVGAYLMADIAHIAGLVATGHHPNPVPICDVVTTTTHKTLRGPRGGLILTRDPELGKKLDKAVFPGSQGGPLEHVIAGKAVAFGEALQPSFAQYSAQVIANAQALAATLQRRGIRLVSGGTDNHLVLLDLRSVSAVLEKNGAADPVMTGKRADRLMEEIHITANKNTIPFDPQPPSVASGLRLGSPALTTRGLGPAEFEEIGEIIADCLFQPGDPGVLEACRRRVAELCRRFPLYPHLG

glyA

Serine hydroxymethyltransferase

433 amino acids

Catalyzes the reversible interconversion of serine and glycine with the modified folate sulfopterin serving as the one-carbon carrier. Cannot use tetrahydrofolate (THF or H4PteGlu) as the pteridine substrate. Also exhibits a pteridine-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism. Thus, is able to catalyze the cleavage of both allo-threonine and beta-phenylserine.

Belongs to the SHMT family.

48.509 kDa

MSLPKELEKVLEITKAQNVWRRTQTLNLIASENVMSPLAESVYMSDFMSRYAEGKPYKRYYQGTKYTDEIETLTMELMNEITNSKDCDLRPTSGTIANAAVFRVLAEPGDKALIAPVQAGAHVSHTKFGTLGALGIQHIEMPFDEENINVDVDKAIKMIEEVKPKFVVLGGSLYLFPHPTKELAQHVHAVGAKLVYDAAHVYGLIEGKVWSNPLKDGADIMTVSTHKTFPGPQGGAIFSDGSEVFKQVSKTIFPWFVSNHHLHRLPATAVTAIEMKYFGESYANQILRNSKALAEALAERGFKVIGENLGYTKSHQVAVDVRQFGGGNKIAKLLEDANIIVNKNLLPYDKPEDVSDPSGLRIGVQEMTRYGMKEGEMEEIAELFKKVIIDKKDVNEVKKEVIEMRRNFLEVKYTFDDMKDLEKYSSKSLKLII

glyA

Serine hydroxymethyltransferase

433 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

46.306 kDa

MTASAKPVSSVDSFFSATLAEADPEIAAAIRGELGRQRHEIELIASENIVSRAVLEAQGSVMTNKYAEGYPGARYYGGCEWVDVAENLAIDRAKKLFGANFANVQPNSGSQMNQAVFLALLQPGDTFMGLDLAAGGHLTHGSPVNMSGKWFKAAHYTVRRDDHLIDMDAVAKQAEEVKPKLIIAGGSAYSRPWDFKRFREIADSVGAYLLVDMAHFAGLVAGGVHASPVPYAHITTTTTHKSLRGPRGGLMLWNDEQFTKKFNSAIFPGLQGGPLMHVIAAKAVAFAEALRPEFKAYAKNVVENAKALAESLRAQGFDIVSGGTDNHLMLVDLRPKGLKGNVSEKALVRAAITCNKNGIPFDPEKPFVTSGLRLGTPAATTRGFGVAEFQQVGSLIAEVLNAIAQGPDGSAPLVEAAVKEKVKALTDRFPIYQ

glyA

Serine hydroxymethyltransferase

433 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

46.134 kDa

MSTSAKHTSAPDSFFSASLEQADPEIAAAIKGELGRQRHEVELIASENIVSRAVLEAQGSVMTNKYAEGYPGARYYGGCEFVDVAENLAIERAKKLFGAGFANVQPNSGSQMNQAVFLALLQPGDTFMGLDLAAGGHLTHGATVNMSGKWFKPVHYTVRREDGIIDMDAVAKLAEETRPKLIIAGGSAYSRAWDFKRFREIADSVGAYFMVDMAHFAGLVAGGAHASPVPHAHVCTTTTHKSLRGPRGGLILTNDEALAKKFNSAIFPGLQGGPLMHVIAAKAVAFKEALQPDFKVYAKNVVENAKALAETLRAAGFDLVSGGTDNHLMLVDLRPKGLKGNVSEKALVRAAITCNKNGIPFDPEKPFVTSGLRLGTPAATTRGFGVAEFQQVGNLIAEVLNAIAQSPDGAAPLVEASVKQRVKELTDRFPIYQ

glyA

Serine hydroxymethyltransferase

433 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

46.178 kDa

MSTSAKTQSAPDQFFSASLAEADPEIAAAIAGELGRQRHEIELIASENIVSRAVLEAQGSVMTNKYAEGYPGHRYYGGCEFVDVAENLAIDRAKKLFGAGFANVQPNSGSQMNQAVFLALLQPGDTFMGLDLAAGGHLTHGATVNMSGKWFKPVHYTVRREDGIIDMDEVAKIAEANKPKLIIAGGSAYSRAWDFKRFREIADSVGAYFMVDMAHFAGLVAGGVHASPVPHAHVCTTTTHKSLRGPRGGLILCNDEALAKKFNSAIFPGLQGGPLMHVIAAKAVAFKEALQPDFKVYAKNVVENAKALAETLRGHGFDIVSGGTDNHLMLVDLRPKALKGNVSEKALVRAGITCNKNGIPFDPEKPFVTSGIRLGTPAATTRGFGVAEFQQVGGMIAEVLNAIAQSSDGQAPLVEAAIRQRVKELTDRFPIYS

glyA

Serine hydroxymethyltransferase

433 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

46.543 kDa

MSDSPQTIQHNVPLAELDPDVARAIDGELARQRNTLEMIASENFVPRAVLQAQGSVLTNKYAEGYPGRRYYGGCEHVDVIEDLARDRAKQVFGAEFANVQPHAGAQANAAVLMALASPRDKILGLSLAHGGHLTHGMHLNFSGKLYEAIAYEVDPETMRIDMDKVREQALKEKPTVIIAGWSAYPRHQDFAAFRSIADEVGAKLWVDMAHFAGLVAAGLHPSPVPHADVVSTTVHKTLGGPRSGLILAKQEWAKKLNSAVFPGQQGGPLMHAVAAKAVAMKVAQTEEFRDRQARTLEGAKILAERLSAADTKGAGVEVLTGGTDVHLVLADLRHSELDGQQAEDLLHEVGITVNRNAVPFDPRPPMVTSGLRIGTPALASRGLDTAAFTEVADVIGTALAQGKNADVEALRARVSKVAEDFPLYEGLEDWKLV

glyA

Serine hydroxymethyltransferase

433 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

46.008 kDa

MSAGTAKTPLSNSFFSASLADVDPELSRAVQQELGRQQHEIELIASENIVSRAVLEAQGSVLTNKYAEGYPGRRYYGGCEFVDIAENLAIERAKRLFGCDFANVQPNSGSQANQAVFMATMQPGDTFLGLDLAAGGHLTHGAPPNVSGKWFKPVSYTVRREDQRIDMEQVAKLAEEHKPKVIIAGGSGYPRHWDFAKFREIADSVGAVFFVDMAHFAGLVAGGVHPSPFPHAHVVTTTTHKTLRGPRGGMVLTNDEALAKKINSAVFPGLQGGPLMHVIAGKAVAFGEALSPDFKIYAKQVVENAKALADTIISGGFDITTGGTDNHLMLVDMRPKNLTGKAAEAALSRAGITCNKNGVPFDPQKPTVTSGIRLGTPAATSRGFGVAEFKKVGELIVTVLDGLARAGEAGDGAAEKKVLEEVHALTDRFPIYA

glyA

Serine hydroxymethyltransferase

433 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

46.223 kDa

MDSSAKTASAPDPFFAGTLAEADPEIAAAITGELGRQRHEIELIASENIVSRAVLEAQGSVMTNKYAEGYPGARYYGGCEWVDVAETLAIERAKKLFGARFANVQPNSGSQMNQAVFLALLQPGDTFMGLDLAAGGHLTHGAPVNMSGKWFKVAHYTVRRDDHLIDMDEVARRAEEVKPKLIIAGGSAYSRPWDFKRFREIADSVGAYLMVDMAHFAGLVAGGVHASPVPHAHVTTTTTHKSLRGPRGGLILCNDEALAKKFNSAIFPGLQGGPLMHVIAAKAVALGEALRPDFKIYAKNVVENARALAESLRGHGFDIVSGGTDNHLMLVDLRPKGLKGNVSEKALVRAGLTCNKNGIPFDPEKPFVTSGLRLGTPATTTRGFGVSEFKQVGGLIAEVLTAIAQAEDGKAPLVEAAVKEKVKALTDRFPIYQ

glyA

Serine hydroxymethyltransferase

433 amino acids

Catalyzes the reversible interconversion of serine and glycine with a modified folate serving as the one-carbon carrier. Also exhibits a pteridine-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

48.457 kDa

MSFPKELEKVLEITKAQNVWRRTQTLNLIASENVMSPLAESVYMSDFMSRYAEGKPYKRYYQGTKYTDEIETLAMDLMNEITNSKDCDLRPTSGTIANAAVFRVLAEPGDKALIAPVQAGAHVSHTKFGTLGALGIQHIEMPFDEENINVDVDKAIKMIEEVKPKFVVLGGSLYLFPHPTKELAPHVHAVGAKLVYDAAHVYGLIEGKVWSSPLKEGADIMTVSTHKTFPGPQGGAIFSDGSEVFKQVSRTIFPWFVSNHHLHRLPATAVTAIEMKYFGESYANQITRNSKALAEALAERGFKVIGENLGYTKSHQVAVDVRQFGGGNKIAKLLEDANIIVNKNLLPYDKPENVSDPSGLRIGVQEMTRYGMKESEMEEIAELFKKVIIDKKDVNKVKKEVIDMRKNFLEVKYTFDDMKDLEKYSSKSLKLII

glyA

Serine hydroxymethyltransferase

433 amino acids

Catalyzes the reversible interconversion of serine and glycine with a modified folate serving as the one-carbon carrier. Also exhibits a pteridine-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

48.458 kDa

MSFPKELEKVLEITKAQNVWRRTQTLNLIASENVMSPLAESVYMSDFMSRYAEGKPYKRYYQGTKYTDEIETLAMDLMNEITNSKDCDLRPTSGTIANAAVFRVLAEPGDKALIAPVQAGAHVSHTKFGTLGALGIQHIEMPFDEENINVDVDKAIKMIEEVKPKFVVLGGSLYLFPHPTKELAPHVHAVGAKLVYDAAHVYGLIEGKVWSSPLKEGADIMTVSTHKTFPGPQGGAIFSDGSEVFKQVSRTIFPWFVSNHHLHRLPATAVTAIEMKYFGESYANQITRNSKALAEALAERGFKVIGENLGYTKSHQVAVDVRQFGGGNKIAKLLEDANIIVNKNLLPYDKPENVSDPSGLRIGVQEMTRYGMKESEMEEIAELFKKVIIDKKDVNEVKKEVIDMRKNFLEVKYTFDDMKDLEKYSSKSLKLII

glyA

Serine hydroxymethyltransferase

433 amino acids

Catalyzes the reversible interconversion of serine and glycine with a modified folate serving as the one-carbon carrier. Also exhibits a pteridine-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

48.472 kDa

MSFPKELEKVLEITKAQNVWRRTQTLNLIASENVMSPLAESVYMSDFMSRYAEGKPYKRYYQGTKYTDEIETLAMDLMNEITNSKDCDLRPTSGTIANAAVFRVLAEPGDKALIAPVQAGAHVSHTKFGTLGALGIQHIEMPFDEENINVDVDKAIKMIEEVKPKFVVLGGSLYLFPHPTKELAPHVHAVGAKLVYDAAHVYGLIEGKVWSSPLKEGADIMTVSTHKTFPGPQGGAIFSDGSEVFKQVSRTIFPWFVSNHHLHRLPATAVTAIEMKYFGESYANQITRNSKALAEALAERGFKVIGENLGYTKSHQVAVDVRQFGGGNKIAKLLEDANIIVNKNLLPYDKPENVSDPSGLRIGVQEMTRYGMKESEMEEIAELFKKVIIDKKDINEVKKEVIDMRKNFLEVKYTFDDMKDLEKYSSKSLKLII

glyA

Serine hydroxymethyltransferase

433 amino acids

Catalyzes the reversible interconversion of serine and glycine with a modified folate serving as the one-carbon carrier. Also exhibits a pteridine-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

48.379 kDa

MSQIPKELEKVIELTREQNRWRRTEVINLIASENVMSPLAETVYMSDFMSRYAEGKPYKRYYQGTKYVDEVETLAMQLMNEITNTKFCDLRATSGTIANAAVFRVLANPGEKALIAPVQAGAHVSHTKFGTLGALGIEHIELPYDADKMNVDVDKAIKMIEQIKPKFIVMGGSLYLFPHPVKELAPHAHAVGAKVVYDAAHVYGLITGKAWHNPLEEGADIMTSSTHKTFPGPQGGAVFSNEEEIFKKVADTIFPWFVSNHHLHRLPATAVTALEMKYFGEDYAKQITKNAKAFAEALAAEGFKVIGEHLGYTQSHQVVLDVRNLGGGAKIAKLFEDANIITNKNLLPYDPPSAVKDPSGIRLGVQEMTRFGMKEEEMREIAKLMREVAIDGKDPNEVKKKVIEFRKNYLEVKYTFSVDLSKYSNGKMLPLLI

glyA

Serine hydroxymethyltransferase

433 amino acids

Catalyzes the reversible interconversion of serine and glycine with a modified folate serving as the one-carbon carrier. Also exhibits a pteridine-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

48.545 kDa

MLDNKKEYLKDAMFIRDMAMQHEQLFRESIPLIASENIMSPLAMEMLLTDLGFRYAEGLPHHRYYQGNEYVDVIEDKTTELGKRLFNSKTFDPRPLSGTNANMAVLYALTEPGDKISVPPLSGGGHISAAKFGAVGFRGLKTVQYPFDINEMNIDIDGTIKTIKNERPKVCWFGQSVFLFPTPLKELQDAFNEVNARVVYDGAHVAGLIAGGEFQDPLREGAEIITGSTHKTLPGPQHGMIIGNTDDDTWKKVQRGVFPGTLSNHHLNAMAALGVTLAEELDFGRDYAKQIVKNARHLGEKLYEFGFNVLGEKNGFTRSHTLAVDVSKNGGGRKVAENLEKSGIILNKNLLPWDDNKNSQNPSGIRIGVQEITRIGFMEDDVTELAEILRDAVINEKPVNEIRRRALELKSRFNNIEYCYGNMKPYSYIKIFE

glyA

Serine hydroxymethyltransferase

432 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

47.279 kDa

MSALRNQDPEIHDVIQKEVQRQNDGLELIASENFASRAVMEAMGTALTNKYAEGLPGKRYYGGCEVVDRAEELARERAKELYDCDWVNVQPHAGAQANSAVYLTLLDPGDTFLGLDLSHGGHLTHGSPVNFSGILYEAEYYGVEEETGRIDMNRVRDRAKEVQPKMISIGASAYPRDFDYEAFREIADEVGAFLWMDMAHTAGLIAGGVLNDPMPHTHVVTTTTHKTLRGPRGGMILLGDDYENPMGKTARKSGRTKMMSELLDSAVFPGTQGGPLMHVIAAKAVGFKEALKPSFAEYTQQVVDNAQAMGAELRERGYDLVSDGTDNHLVLIDLRNKGLTGKEAEQALEAAGITANKNMVPFDDKSPFVTSGLRLGTPAMTTRGFGPDEFAHVAEMIDRVLQDPEDEDTQAAVEREVKALCDQHPLYDVAMA

glyA

Serine hydroxymethyltransferase

432 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

46.035 kDa

MTSAKTASAPDSFFTASLDQADPEIAAAIKGELGRQRHEVELIASENIVSRAVLEAQGSVMTNKYAEGYPGARYYGGCEWVDVAENLAIDRAKKLFGAGFANVQPNSGSQMNQAVFLALLQPGDTFMGLDLAAGGHLTHGSPVNMSGKWFKAAHYTVRREDQIIDMDAVQKQAEEIKPKLIVAGGSAYSRAWDFKRFREIADSVGAYLLVDMAHFAGLVAGGVHASPVPYAHVTTTTTHKSLRGPRGGLILSNDETLAKKLNSAIFPGLQGGPLMHVIAAKAVAFGEALRPDFKVYAKNVVENAKALAEAMKSHGFDIVSGGTDNHLMLVDLRPKGLKGNVSEKALVRAAITCNKNGIPFDPEKPFVTSGLRLGTPAATTRGFGVAEFQQVGGMIAEVLNAIAQSDDGKAPLVEAAIKERVKALTDRFPIYQ

glyA

Serine hydroxymethyltransferase

432 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

46.394 kDa

MTNASTESFFNRSLADVDPDIFGAIGKELGRQRHEIELIASENIVSRAVLEAQGSIMTNKYAEGYPGKRYYGGCQFVDIAEELAIERAKKLFGVNFANVQPNSGSQMNQAVFLALLQPGDTFMGLDLNSGGHLTHGSPVNMSGKWFNVVSYGVREGDNLLDMDEVARKAEETKPKLIIAGGTAYSRIWDWKRFREIADSVGAYLMVDMAHIAGLVAGGVHPSPFPHCHVATTTTHKSLRGPRGGVILTNDEDLAKKFNSAVFPGLQGGPLMHIIAAKAVAFGEALQPEFKDYAAQVVKNAKALAETLISGGLDVVSGGTDNHLMLVDLRKKNATGKRAEAALGRAYVTCNKNGIPFDPEKPFVTSGVRLGAPAGTTRGFKEAEFREIGNLIVEVLDGLKVANSDEGNAAVEAAVRGKVVSLTDRFPMYGYMG

glyA

Serine hydroxymethyltransferase

432 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

46.622 kDa

MTSASTEPFFNRSLADTDPEIFGAIGKELGRQRHEIELIASENIVSRAVLEAQGSIMTNKYAEGYPGKRYYGGCQYVDIAEELAIERAKKLFGVNFANVQPNSGSQMNQAVFLALLQPGDTFMGLDLNSGGHLTHGSPVNMSGKWFNVVSYGVREGDNLLDMEAVQRKAEETKPKLIIAGGTAYSRIWDWKRFREIADSVGAYLMVDMAHIAGLVAGGQHPSPFPHCHVATTTTHKSLRGPRGGMILTNDEDLAKKFNSAVFPGLQGGPLMHVIAAKAVALGEALQPEFQDYAAQIVKNAKALSETLISGGVDVVSGGTDNHLMLVDLRKKNATGKRAEAALGRAYVTCNKNGIPFDPEKPFVTSGVRLGTPAGTTRGFKEAEFREIGNLIIEVLDGLKVANSDEGNAAVEAAVREKVIKLTDRFPMYGYMG

glyA

Serine hydroxymethyltransferase

432 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

45.773 kDa

MNQQSPIANISRFFNAPLAETDPDLAAAIGRELGRQQDGIELIASENIVSRAVLEAQGSVLTNKYAEGYPGKRYYGGCAAVDIAEELAIARAKELFGCAFANVQPHSGAQANQAVFLALLNAGDTILGMSLAAGGHLTHGAAPNLSGKWFDAVQYGVKREDGTLDYEELERLARERKPKLIIAGGSAYPRFIDFARIRKVADEVGAYFMVDMAHFAGLVAAGIFPSPVPHAHVVTTTTHKTLRGPRGGMILSNDLDLGKKINSAVFPGLQGGPLMHVIAAKAVAFGEALRPEFRAYQKALAENAKVLAETLVEGGLDIVTGGTDCHLMLVDLRPKNVTGKAAEASLERAHMTANKNAIPFDPAKPAVTSGIRLGTPAATTRGFGPDEFRMVGRFIVEVLDGLSASNDGDNAAVEAAVGAKVLELCARFPIYR

glyA

Serine hydroxymethyltransferase

432 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

46.996 kDa

MIKRENDLQQCFFNDTLQTVDAAVFDAVSGELRRQCDEIELIASGNIVSRAVLEAQGSVLTNKYAEGYPGKRYYGGCHFVDRIEELAIERAKNLFGAAFANVQPNSGSQMNQAVFLALLQPGDTFMGLDLSSGGHLTHGSPVNMSGKWFNRIAYGLRQEDQLLDIESVERLAKEHKPKLIFAGGTAYSRIWDWKRFREISDEVGAYLVVDMAHIAGLVAGGVHPSPIPHAHIVTTTTHKSLRGPRGGMILTNDEVLAKKINSAVFPGLQGGPLMHVIAAKAVALGEALQPAFKDYAAKVVANAKILAENLQNNGFTIVSGGTDNHLLLVDLRNKSLTGKHAELALERASIICNKNNIPFDPQLPSITSGIRLGTPAATTRGFAENEFIQISDLISEVLDGLTIAKNDDENFLVEAAVKKKVKNITDNFPFYS

glyA

Serine hydroxymethyltransferase

432 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

46.598 kDa

MTNASTESFFNRSLADVDPEIFGAIGKELGRQRHEIELIASENIVSRAVLEAQGSIMTNKYAEGYPGKRYYGGCQFVDIAEELAIERAKKLFGVNFANVQPNSGSQMNQAVFLALLQPGDTFMGLDLNSGGHLTHGSPVNMSGKWFNVVSYGVREGDNLLDMDEVARKAEEHKPKVIIAGGTAYSRIWDWKRFREIADSVGAYLMVDMAHIAGLVAGGQHPSPFPHCHVATTTTHKSLRGPRGGVILTNEEDLAKKFNSAVFPGLQGGPLMHIIAAKAVAFGEALQPEFKEYAAQIVKNARALAETLIAGGLDVVSGGTDNHLMLVDLRKKNATGKRAEAALGRAYITCNKNGIPFDPEKPFVTSGVRLGAPAGTTRGFKEAEFREIGNLIVEVLDGLKVANSDDGNAAVEAAVRGKVVNLTDRFPMYDYMG

glyA

Serine hydroxymethyltransferase

431 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

47.153 kDa

MITAPIRTTARDTQIFDLISKEAHRQEEGIELIASENFTSKQVMEAMGSVLTNKYAEGLPGKRYYGGCQVVDQVEQIAIDRLKKLFGAEWANVQPHSGAQANAAIMIACLNPGDSILGFDLSHGGHLSHGSPVNMSGKYFKAHFYGVEKESGLINMDIVEATALKVKPKMIICGASAYSRDWDYARFRKIADSVGAILLADISHPAGLIAKGLLNDPIPHCHIVSTTTHKTLRGPRGGVIMMGKDFENPFGLKTPKGETRMMSNVLDMGVFPGTQGGPLEHVIAAKAVAFQEALSTDYLQYAKQIQKNAQIMAEAFLKKGYDIISGGTDNHLMLIDLRSKNLTGKEAENALIRADITINKNMVPFDDKSPFVTSGMRVGTAAITSRGMVGDDMIRIVEMIDTVLMNQTKDSVIETVRKDVNNWMAQYPLYI

glyA

Serine hydroxymethyltransferase

431 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

47.153 kDa

MITAPIRTTARDTQIFDLISKEAHRQEEGIELIASENFTSKQVMEAMGSVLTNKYAEGLPGKRYYGGCQVVDQVEQIAIDRLKKLFGAEWANVQPHSGAQANAAIMIACLNPGDSILGFDLSHGGHLSHGSPVNMSGKYFKAHFYGVEKESGLINMDIVEATALKVKPKMIICGASAYSRDWDYARFRKIADSVGAILLADISHPAGLIAKGLLNDPIPHCHIVSTTTHKTLRGPRGGVIMMGKDFENPFGLKTPKGETRMMSNVLDMGVFPGTQGGPLEHVIAAKAVAFQEALSTDYLQYAKQIQKNAQIMAEAFLKKGYDIISGGTDNHLMLIDLRSKNLTGKEAENALIRADITINKNMVPFDDKSPFVTSGMRVGTAAITSRGMVGDDMIRIVEMIDTVLMNQTKDSVIETVRKDVNNWMAQYPLYI

glyA

Serine hydroxymethyltransferase

431 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

45.908 kDa

MTDATRDPGFFTQSLSERDPELFGAITDELGRQRDEIELIASENIVSAAVMEAQGSVLTNKYAEGYPGRRYYGGCQYVDVAENLAIDRAKQLFNCEFANVQPNSGSQANQGVFQAILKPGDTILGMDLASGGHLTHGAAPNQSGKWFNAVHYGVRESDCLIDYDQVQALATEHQPKLIIAGGSAIPRQIDFAKFREIADSVGAYLLVDMAHFAGLVAAGEHPSPFPHADVATTTTHKTLRGPRGGMILTNNPDLAKKFNSAIFPGIQGGPLMHVIAGKAAAFGEALKPEFKSYQKQVRANAVALADELIKGGLDIVTGGTDTHVMLVDLRPKGVTGNIVDKALGRAHITTNKNGIPFDPEKPTVTSGIRLGTPAGTTRGFGEEEFREIARLIVEVVDGLAANGEDGNAAVEEAVRGKVAALCGRFPLYPNL

glyA

Serine hydroxymethyltransferase

431 amino acids

Catalyzes the reversible interconversion of serine and glycine with a modified folate serving as the one-carbon carrier. Also exhibits a pteridine-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

47.433 kDa

MNLSDAINAVNRVKDIINSHNTWRRKETINLIPSENVMSPLAEYFYINDMMGRYAEGTIGNRYYQGVKYVDEIEAYLVDLMSKLFHASYVDVRPISGTVANMAVYLTLAKGGKIAAVPRQCGGHISHDEVGAPGAFGIKVIHLPCDEENFSINVDSAVKVIREEKPQLVILGASLYLFPHPVKELAQVAHENGAYLMHDSAHVLGLIAGGQFPNSLNEGADLMTSSTHKTFPGPQGGVIFTNNESIFKNIQRAVFPQLTSNYHLHRYASTAITAIEMMTFGESYAYQVRLNAKKLAEELSKYGIPVVAEARGFTETHQVVFDASKFGGGAKVAQLLEDGGIIVNKNMLPWDRSAVRPSGIRMGVQEMTRVGMGTQEMAEIAAFMKAILIDGKEPSSVKGEVKEFKAHYTEVKYGFKLSDVGIKCDCLPLNY

glyA

Serine hydroxymethyltransferase

431 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

45.734 kDa

MNAPHRDDGFFTESLSSRDPELFASITGELGRQRDEIELIASENIVSRAVMEAQGSVMTNKYAEGYAGKRYYGGCDYVDVAETLAIERAKQLFGCAYVNVQPNSGSQANQGVFQALIKPGDTILGMELASGGHLTHGAAPNQSGKWFNAIQYGVRQQDQLIDYDQVAALAREHKPKLIIAGGSAIPRQIDFARFRAIADEVGALLMVDMAHFAGLVAGGAHPSPFPHADVATTTTHKTLRGPRGGMILTNSEEIAKKVNSAIFPGIQGGPLMHVIAAKAVAFGEALRPEFKAYAAQVVKNAQALADELMKGGLDIVTGGTDTHLMLVDLRPKGVKGNATEKALGRAHITCNKNGIPFDPEKPTVTSGVRLGTPAGTTRGFGEAEFREIGRLIVEVVDGLAANGEEGNAAVEEAVKAKVAALCARFPLYPTL

glyA

Serine hydroxymethyltransferase

431 amino acids

Catalyzes the reversible interconversion of serine and glycine with a modified folate serving as the one-carbon carrier. Also exhibits a pteridine-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

48.305 kDa

MDVQKELEKVIELTRSQNRWRRTETINLIASENVMSPLAEALYMSDFMSRYAEGKPFKRFYQGTKYVDEVETLAMDYMNQVTGSKFCDLRPTSGTLANAAVFRVLANPGDKALIAPVQAGAHVSHTKFGTLGALGIEHIEMPYDEENMNVDVDRAVKMIEQIKPKFVVLGGSLYLFPHPTKDLAPHVHSVGAKLVYDAAHVYGLMTGKVWSNPLDEGADFLNVSTHKTFPGPQGGAIFSNEEEEFKKVSRTIFPWFVSNHHLHRLPSTAVTALEMKVYGEDYAKQITRNSKALAEALASFGFKVIGEHLGYTKSHQVAVDVKNLGGGAYVAKTLESANIIVNKNLLPHDPPEAVNDPSGIRIGVQEMTRFGMKEGEMEEIAELMKQILVDKRDINEMRRKVTEMRSRFLEVKYALTYDLSKYNSKLIPMIL

glyA

Serine hydroxymethyltransferase

431 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

45.885 kDa

MSASALDAFFGARLADTDPDLFAALEKEFHRQEDGIELIASENIVSAAVLEAQGSVLTNKYAEGYPGKRYYGGCAAVDIAEQLAIDRAKQLFGCEFANVQPHSGAQANGAVFFALAKPGDTILGMSLAAGGHLTHGAAPTVSGKWFNAVQYGVRKEDGLLDYEELEALAREHKPKIIIAGGSAYPRFIDFPRIRKVADEVGAYFMVDMAHFAGLVAAGIYPSPLPHAHVVTTTTHKTLRGPRGGMILTNDLELGKKFNTAVFPGLQGGPLMHVIAAKAVAFGEALKPDFKTYQQSVANNAKVLASTLVERGLAIVSGGTDTHLMLVDLRPKNVTGKATDESLGRAHITTNKNAIPFDPQKPAVTSGIRLGTPAGTSRGFGEAEFREIGLMIDRVVEGLSKAGENGSNEAVEQEVGAEVKALCKRFPLYRNH

glyA

Serine hydroxymethyltransferase

431 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

46.06 kDa

MTQTTASVNTQSLGELDPELAAAMAGELARERDTLEMIASENFVPRAVLQAQGSVLTNKYAEGYPGRRYYGGCENVDVVENLARERAKELFGAEFANVQPHSGAQANAAVLMSLMDPGDRLLGLDLAHGGHLTHGMRLNFSGKLYEVHSYGVSKEDHRVDMDEVRTIALGAKPKVIVAGWSAYPRHQDFAAFRAIADEVGAYLWVDMAHFAGLVAAGLHPSPVPYADVVSSTVHKTLGGPRSGLILAKQEFAKKINSAVFPGQQGGPLMHAIAAKAVAFKIAGTEEFRDRQQRTLSGAKILAERLTGADVADKGISVLTGGTDVHLVLVDLRNSQLDGQQGEDLLHEIGITVNRNAVPFDPRPPMVTSGLRIGTAALATRGFGDAEFTEVADIIATALAGGSDAETLRGRVRALAQRVPLYQGLEDWHLLG

glyA

Serine hydroxymethyltransferase

431 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

46.404 kDa

MSQASGRAIDADLAQSDPDIAAFINQERQRQETHLELIASENFASRAVMQAQGSVLTNKYAEGLPSKRYYGGCEHVDAIEELAIERAKQLFGAAWANVQPHSGAQANFAVFLALLQPGDTIMGLDLSHGGHLTHGSPVNVSGKWFNVVQYGVDKETQRLDMEAIRQLALEHKPKLIVCGYSAYPRTIDFAAFRAIADEVGAYLLADMAHIAGLVAAGVHPSPVPHCDVVTTTTHKTLRGPRGGLILCRDAEFAKKFDKAVFPGSQGGPLEHVIAAKAVAFGEALQPSFKAYSQQVVANAAALAEQLIARGIDVVSGGTDNHVVLLDLRSIGMTGKVADLLVSDVHITANKNTVPFDPESPFVTSGLRFGTAALTTRGFDSQAFREVADVIADRLFNPEDDAIRQRCLDRVGALCERFPLYADSKHKQPVLV

glyA

Serine hydroxymethyltransferase

431 amino acids

Catalyzes the reversible interconversion of serine and glycine with a modified folate serving as the one-carbon carrier. Also exhibits a pteridine-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

48.226 kDa

MAEGYREYRDKVLGFIEDHENWRKHTINLIASENVTSPSVTRAVASGFMHKYAEGWPKQRYYQGCKYVDEVELIGVELFTKLFGSDFADLRPISGTNANQAVFFGLTQPGDKAIVLHTSHGGHISHMPFGAAGMRGLEVHTWPFDNEEFNIDVDKAEKLIREVEPKIVVFGGSLFPFPHPVKELAPVAKEVGAYVMYDGAHVLGLIAGKQFQDPLREGADIITASTHKTFPGPQGGVIIYKRFGETEEIAKLQWAIFPGVLSNHHLHHMAGKVITAAEMLEYGEKYAAQIVKNAKALAEALAEEGFKVIGEDKGYTESHQVIVDVSDLHPAAGGWAAPLLEEAGIILNKNLLPWDPLEKVNEPSGLRIGVQEMTRVGMMEDEMKEIARFIRRVLIDKEDPAKVRRDVYGFRAEYQKVYYSFDHGLPLRLRE

glyA

Serine hydroxymethyltransferase

430 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

45.747 kDa

MVGYIGNVDIGVFDAEVANSMSAELERQNTLLQMIASENFVSRAVLQAQGSVLTNKYAEGYAGSRYYCGCALVDVVENLAVERLCRLFGCKFANVQPHSGSQANQQVFMALLKPGDTILGMSLDCGGHLTHGAAPNVSGRWFNAVSYGVNRDTGLIDMDEVEALALSAKPSLIIAGASSYPRRIDFAAFRAIADKVGAYLLADIAHYSGLIAGGCYPSPFGHAHVVTSTTHKTLRGPRGAVIMTDDEEIHKKIRLSVFPGMQGGPLMHVIAAKAVAFKEALHPDFKLYAQQVLENSRVLAGVLSSEGLDVVTGGTDSHIVLLDLRSKGVTGREVSSSLERAGIVCNKNAVPFDTEKPWVTSGIRLGSAAETSRGLGVPEFESIGRLVAKVVNACSLGQEKMSAAEAEVRREVNGLVRSLPMSAFPVCEVC

glyA

Serine hydroxymethyltransferase

430 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

45.747 kDa

MVGYIGNVDIGVFDAEVANSMSAELERQNTLLQMIASENFVSRAVLQAQGSVLTNKYAEGYAGSRYYCGCALVDVVENLAVERLCRLFGCKFANVQPHSGSQANQQVFMALLKPGDTILGMSLDCGGHLTHGAAPNVSGRWFNAVSYGVNRDTGLIDMDEVEALALSAKPSLIIAGASSYPRRIDFAAFRAIADKVGAYLLADIAHYSGLIAGGCYPSPFGHAHVVTSTTHKTLRGPRGAVIMTDDEEIHKKIRLSVFPGMQGGPLMHVIAAKAVAFKEALHPDFKLYAQQVLENSRVLAGVLSSEGLDVVTGGTDSHIVLLDLRSKGVTGREVSSSLERAGIVCNKNAVPFDTEKPWVTSGIRLGSAAETSRGLGVPEFESIGRLVAKVVNACSLGQEKMSAAEAEVRREVNGLVRSLPMSAFPVCEVC

glyA

Serine hydroxymethyltransferase

430 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

45.729 kDa

MVGYIGNVDIGVFDAEVANSISAELERQNTLLQMIASENFVSRAVLQAQGSVLTNKYAEGYAGSRYYCGCALVDVVENLAVERLCRLFGCKFANVQPHSGSQANQQVFMALLKPGDTILGMSLDCGGHLTHGAAPNVSGRWFNAVSYGVNRDTGLIDMDEVEALALSAKPSLIIAGASSYPRRIDFAAFRAIADKVGAYLLADIAHYSGLIAGGCYPSPFGHAHVVTSTTHKTLRGPRGAVIMTDDEEIHKKIRLSVFPGMQGGPLMHVIAAKAVAFKEALHPDFKLYAQQVLENSRVLAGVLSSEGLDVVTGGTDSHIVLLDLRSKGVTGREVSSSLERAGIVCNKNAVPFDTEKPWVTSGIRLGSAAETSRGLGVPEFESIGRLVAKVVNACSLGQEKMSAAEAEVRREVNGLVRSLPMSAFPVCEVC

glyA

Serine hydroxymethyltransferase

430 amino acids

Catalyzes the reversible interconversion of serine and glycine with a modified folate serving as the one-carbon carrier. Also exhibits a pteridine-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

47.706 kDa

MLPREIEELLNIILQHNTWRRKETINLIASENVMSPLAELVYVNDFAGRYAEGTVGNRYYQGTKYVDILEDSLSKRFAKVLDAKFVDVRPISGTIANLATYHALVPEGGIVASLPVKYGGHISHNTVGGLKALRVKTVELPWDFENFNIDIDAARKIIEEKRPNLIILGASLYLFPHPVREIANAAKAVGAYVLHDSAHVFGLIIGGVFPNPLKEGAHVITSSTHKTFPGPQGGLIASVTDEELNNAIQRAVFPVFTSNYHLHRYAATYVTLIEMEHFGAEYGARIVENAKALAEALAEEGVTPVGERLGYTKTHQVAVDVSKFGGGDKVARLLEEANIIVNKNALPWDKSVLKPSGIRMGVQEMTRFGMGKGEMKEIAKFIARVLKGEDPTAVKREVVEFRKTFIEIKYGFKIDKEIIDKIFYSLNLYT

glyA

Serine hydroxymethyltransferase

430 amino acids

Catalyzes the reversible interconversion of serine and glycine with a modified folate serving as the one-carbon carrier. Also exhibits a pteridine-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

47.284 kDa

MIPREIKEVLDVVLRHNRWRRWETINLIASENVMSPLAEIFYINDFGGRYAEGTIGSRYYQGTKYVDVVEEALVKEFAEVLGAKFVDVRPISGTVANLATYFALVPEGGSVASLPIRCGGHISHSNVGGLKALRIKTVELPWDLENFNVDVDAARKVLEDKRPNLVILGGSLYLFPHPIKEVAEIAKGIGAYVLHDSAHVLGLIVGGVFPNPLREGADVITSSTHKTFPGPQGGLIATNLGDDANGQIQKAVFPTFTSNYHLHRYVATYITLVEMKLFGHEYASRVVENAKALAEALAEEGVTPVAERLGFTKTHQVAVDVSKYGGGDKVAALLEEANIIVNKNALPWDRSVVKPSGIRIGVQEMTRFGMGKDEMREIAKFIARVLRGEDPASVRRDVVDFRRGFVEVKYGFKASREVIEEVFASLNLLA

glyA

Serine hydroxymethyltransferase

430 amino acids

Catalyzes the reversible interconversion of serine and glycine with a modified folate serving as the one-carbon carrier. Also exhibits a pteridine-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

47.664 kDa

MLPQEVENILDVVIRHNTWRRKETINLIASENVMSPLAELVYINDLAGRYAEGIVGSRYYQGVRYVDILEDALSKKFANVLGARFVDVRPISGTIANLAAYFALVPEGGTVASLPIKYGGHISHNTVGGLKALRLKAVELPWDLENFNIDVDAARKLIEEKRPNLIILGASLYLFPHPVKEIAEVAKTVGAYVLHDSAHVFGLIVGGAFPNPLREGAHLTTASTHKTFPGPQGGVIATVLDEEKNSQIQRAVFPTFTSNYHLHRYAATYVTLVEMEVFGREYATRIVENARALAEALAAEGVPPVAERQGYTKTHQVAVDVSKFGGGDKVAALLEEANIIVNKNALPWDKSVLKPSGIRIGVQEMTRFGMGKDEMREIARFIARVLRGEDVNNIKRDVVEFRKSYLEIKYGFKISRDIVDKIFHSLNLYT

glyA

Serine hydroxymethyltransferase

430 amino acids

Catalyzes the reversible interconversion of serine and glycine with a modified folate serving as the one-carbon carrier. Also exhibits a pteridine-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

47.441 kDa

MLPRELGEILDVVTRHNAWRRKETINLIASENVMSPLAELYYINDLAGRYAEGTVGNRYYQGTRYVDVLEDALVKKFSAVLEAKFVDVRPISGTVANLATYFALTPEGGTVASLPVKYGGHISHNTVGGVKALRLKTVELPWDLENFNVDVDAARKLIEEKRPNLIILGASLYLFPHPVKEVAEAAKTVGAYVLHDSAHVFGLIVGGVFPNPLKEGAHVTTASTHKTFPGPQGGVIATALDDERNSQIQRAVFPTFTSNYHLHRYAATYVTLVEMEVFGREYASRIVENARALAEALASEGVPPVAEKLGYTRTHQVAVDVSKFGGGDKAAALLEEANVIVNKNALPWDKSVLKPSGIRMGVQEMTRFGMGKDEMREIARFIARVLRGEDPAAVRRDVVEFRKSYLEIKYGFKIDRGEVEKVFNSLNLNT

glyA

Serine hydroxymethyltransferase

430 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

45.756 kDa

MTDTLPSTFTASLAEVDPEIAEVLQLELGRQRDYLEMIASENFVPRAVLESVGSVLTNKYAEGYPGRRYYGGCEYVDIAEQLAIDRAKSLFGAEYANVQPHSGASANAAVLSAIATPGETILGLELAHGGHLTHGMKLNFSGKLYNAVAYGVDPETFLVDMDAVRDRALEHKPQVIIAGWSAYPRQLDFAAFRAIADEVGAKLWVDMAHFAGLVAAGLHPSPVPYADVVSSTVHKTLGGPRSGFIVSRDTELAKKLNSNVFPGQQGGPLMHVIAAKATAFKLAATDEFKDRQARTIRGAQLLAERLTAADSRASGVDVLTGGTDVHLVLADLRTSELDGQQAEDILHEVGITVNRNAVPFDPRPPMVTSGLRIGTPALATRGFGDTEFTEVADIIALALRPGADTRALRARVDALTAAFPLYPGLAPSAS

glyA

Serine hydroxymethyltransferase

429 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydromethanopterin (H4MPT) serving as the one-carbon carrier. Also exhibits a pteridine-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

47.669 kDa

MNPSEVQQFVRETALKQHNWMRECIKLIASENITSIPVREACATDFMHRYAEGLPNNRLYQGCEYIDDIENLCIELSEDIFKAEHANVQPTSGVVANLAVFFAEAKPGDKLMAMDVPNGGHISHWKVSAAGIRGLRASAHPFDAEEMNIDVDKMVKQILEEKPRLVLFGGSLFPFPHPVKDAVDAANEVGATIAYDGAHVLGLIAGGQFQDPLREGAEYMMGSTHKTLFGTQGGVVLTEKKNAKKIDDKIFPGVVSNHHLHHKAGLAIALAETKEFGEAYAKQVVKNAKALGQALYERGCNVLCEHKGFTESHQVILDIEKSECIEFSARELATMFEEANIILNKNLLPWDDVSNSDNPSGIRLGSQECTRLGMKESEMDEIAEFMKRIAIDGEDIKKVKEDIVEFAKSYSEIHYAFEGGDAFKYLKFY

glyA

Serine hydroxymethyltransferase

429 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

47.789 kDa

MPKNTKRKRLCPKMNQKLGLKDQDQEIFDLIEQEKARQKENILLIASENFVSQAVLDAQGSILTNKYAEGYPQARYYNGCKNVDQIEKIAIQRATKLFGAKYANVQPHSGSQANMGVFQALLKPGDKILGLSLMDGGHLTHGHKLSFSGGFYEAHFYNVNPQTEMLDYDEIRKVALAVKPKLIIAGYSAYSKTINFKKFRQIADEVNAYLIADIAHIAGLVACGLHPCPFEANADVVTSTMHKTLRGPRGGLILTNKEELFKKINRGIFPGIQGGPCIHTIAAKAVAFQEAMMPSFKEYQKQVIKNANTFAKAFQQKGYRIVSGSTDNHLFLIDVKHKNTEFTGAKIANMLEKINIVVNKNTIPFDQEKPFVTSGIRIGTPAMTTVGFRENDFVAVADLMDKAINHLDDESYLSQIKQQVLALLSKFNK

glyA

Serine hydroxymethyltransferase

429 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

47.789 kDa

MPKNTKRKRLCPKMNQKLGLKDQDQEIFDLIEQEKARQKENILLIASENFVSQAVLDAQGSILTNKYAEGYPQARYYNGCKNVDQIEKIAIQRATKLFGAKYANVQPHSGSQANMGVFQALLKPGDKILGLSLMDGGHLTHGHKLSFSGGFYEAHFYNVNPQTEMLDYDEIRKVALAVKPKLIIAGYSAYSKTINFKKFRQIADEVNAYLIADIAHIAGLVACGLHPCPFEANADVVTSTMHKTLRGPRGGLILTNKEELFKKINRGIFPGIQGGPCIHTIAAKAVAFQEAMMPSFKEYQKQVIKNANTFAKAFQQKGYRIVSGSTDNHLFLIDVKHKNTEFTGAKIANMLEKINIVVNKNTIPFDQEKPFVTSGIRIGTPAMTTVGFRENDFVAVADLMDKAINHLDDESYLSQIKQQVLALLSKFNK

glyA

Serine hydroxymethyltransferase

429 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

45.827 kDa

MMTQTDLSAFFGADLATADRDIFDRIGRELGRQQNQIELIASENIVSKAVLEAQGSILTNKYAEGYPGKRYYGGCEYVDEIETIAIERAKALFGAGFANVQPHSGSQANQAVFMALLQPGDTFLGMDLAAGGHLTHGSPANQSGKWFKPISYSVRQQDQLIDYDGVAEVAQREKPKLIIAGGSAYSREIDFAKFREIADSIGAYLMVDMAHYAGLIAGGAYANPIPHAHIVTTTTHKTLRGPRGGLVLTNDEAIIKKVNSAVFPGLQGGPLEHVIAAKAVAFGEALQPSFKDYARQVVANARALAEALLKSGVNIVSGGTDSHLMLVDLRPKGVTGRDAEHSLERAYMTCNKNGVPFDTAPFTITSGIRLGTPAGTTRGFKEAEFTRVGELIGEVVNGLAVNGPEGNAAVEAKVREEVLALTGRFPIYN

glyA

Serine hydroxymethyltransferase

429 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

45.813 kDa

MTKETASFFTDRLAAADPDVLTAINHELNRQRKQIELIASENIVSRAVLEAQGSVFTNKYAEGYPGKRYYQGCAPSDEIETLAIERAKKLFGSEFVNVQPHSGAQANGAVLLAVAKPGDTIMGLSLDAGGHLTHGAKAAMSGKWFNAVQYAVHPETQLIDYDQVRDLALKNKPRVIIAGGSAYPRHIDFAFFRKVADEVGATFMVDMAHFAGLVAGGVHPSPVPHAHITTTTTHKTLRGPRGGMILTDDPALAKKINSAVFPGMQGGPLMHVIAAKAVAFGEALQPSFKEYAKAVVENAQALAARLKERGSDLVTGGTDTHLALVDLRPLGVTGRDADCALERAGITCNKNGIPFDPLPPVKTSGIRLGSPAATTRGFRKAEFLQVADMIADVLDALSSKGEQGDPAVETAVRQRVEALCDRFPLYPEL

glyA

Serine hydroxymethyltransferase

429 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

46.219 kDa

MDMQTGSRFFTDRLADSDPDLFQAIRSELTRQQDQIELIASENIVSQAVLEAQGSVLTNKYAEGYAGRRYYGGCEYVDIAETLAIERAKALFGCAYANVQPHSGAQANQAVFMALLQPGDTFMGMDLAAGGHLTHGAPANQSGKWFKVVSYGVRRDDHLIDYEEVEAKAREHRPKLIIAGGSAYPRQIDFARFRRIADEIGAYLMVDMAHYAGLVAAGVYPSPLPHAHVVTTTTHKTLRGPRGGMILSNDPELGKKFNSAVFPGLQGGPLMHVIAAKAVAFGEALRPEFKAYAQAVVDNARVLADRLVAGGLDIVSGGTDSHIVLVDLRPKRLTGKAAEATLEHAGMTCNKNGVPFDPEKPLVTSGVRLGSPAATTRGFGTAEFAQVGDLIVEVLDGLARSNGDNTATETRVREQVRALCHRFPIYPAL

glyA

Serine hydroxymethyltransferase

429 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

46.411 kDa

MANTDAFFSRPLAETDPDIFGAIEKELGRQRHEIELIASENIVSRAVLEAQGSIMTNKYAEGYPGKRYYGGCQFVDIAEELAIERAKKLFGVNFANVQPNSGSQMNQAVFLALLQPGDTFMGLDLNSGGHLTHGSPVNMSGKWFNVVSYGVRQDDNLLDMDAVAESARKHKPKLIIAGGTAYSRIWDWKRFREIADEVGAYLMVDMAHIAGLVAGNQHPSPFPHCHVATTTTHKSLRGPRGGMILTNDEDLAKKFNSAVFPGLQGGPLMHVIAAKAVAFGEALQPEFQDYAAQVVKNAKALSETLVKGGLDIVSGGTDNHLMLVDLRKKNATGKRAEAALGRAYVTCNKNGIPFDPEKPFVTSGVRLGTPAGTTRGFKEAEFIEIGNLIVEVLDGLKVANSDEGNSAVEASVRDKVIGLTGRFPMYPYL

glyA

Serine hydroxymethyltransferase

429 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

46.316 kDa

MTDDIRYQSLTELDPEVAAAITGELDRQRSTLEMIASENFVPRAVLQAQGSVFTNKYAEGYPGRRYYGGCENADIVEDLARNRAKEVFGAEFANVQPHAGAQANAAVLMALANPGDKIMGLSLAHGGHLTHGMHLNFSGKLYEVAAYEVEPDNFRLDMDKIREQALKEKPQVLIAGWSAYPRHQDFAAFRSIADEVDAKLWVDMAHFAGLVAAGLHPSPVPYADVVSTTVHKTLGGPRSGMILSKQEYAKKLNSAVFPGQQGGPLMHAIVAKAVAMKIAATEEFKDRQQRTLDGAQIIAERLTGADCKAAGVDVLTGGTDVHLVLVDLRNSQMDGQQAEDLLHEVGITVNRNAVPFDPRPPMVTSGLRIGTPALATRGFDAAGFTEVADIIATALAQGAGADTEQLRARVAKLAEQYPLYEGLEDWKLL

glyA

Serine hydroxymethyltransferase

429 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydromethanopterin (H4MPT) serving as the one-carbon carrier. The use of tetrahydrofolate (THF or H4PteGlu) as the pteridine substrate is 450-fold less efficient than that of H4MPT. Also exhibits a pteridine-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism. Thus, is able to catalyze the cleavage of L-allo-threonine and L-threo-beta-phenylserine.

Belongs to the SHMT family.

48.084 kDa

MEYSDVPKFIRDVSIKQHEWMRESIKLIASENITSLAVREACATDFMHRYAEGLPGKRLYQGCKYIDEVETLCIELSKELFKAEHANVQPTSGVVANLAVFFAETKPGDKLMALSVPDGGHISHWKVSAAGIRGLKVINHPFDPEEMNIDADAMVKKILEEKPKLILFGGSLFPFPHPVADAYEAAQEVGAKIAYDGAHVLGLIAGKQFQDPLREGAEYLMGSTHKTFFGPQGGVILTTKENADKIDSHVFPGVVSNHHLHHKAGLAIALAEMLEFGEAYAKQVIKNAKALAQALYERGFNVLCEHKDFTESHQVIIDIESSPDIEFSASELAKMYEEANIILNKNLLPWDDVNNSDNPSGIRLGTQECTRLGMKEKEMEEIAEFMKRIAIDKEKPEKVREDVKEFAKEYSTIHYSFDEGDGFKYLRFY

glyA

Serine hydroxymethyltransferase

429 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

45.954 kDa

MVDFETAPINAPLAESDPAIARLIDQERDRQETHLELIASENFASSAVMAAQGSVLTNKYAEGLPNKRYYGGCEHVDAIEDLAIERAKELFGAAWANVQPHSGAQANFAVFLALLQPGDTIMGLDLSHGGHLTHGSPVNVSGKWFNVVQYGVDKETQRLDMEAIRQLALEHKPKLIVCGFSAYPRTIDFAAFRAIADEVGAYLLADMAHIAGLVAAGVHPSPVPHCDVVTTTTHKTLRGPRGGLILCRDAEFAKKFDKAVFPGSQGGPLEHVIAAKAVAFGEALRPAFKAYSQQVVANAQALADRLMARGIDVVSGGTDNHVVLLDLRSIGMTGKVADLLVSDVHITANKNTVPFDPESPFVTSGLRLGTAALTTRGFDADAFAEVAEVIADRLLNPEDDAIQARCLERVASLCRRFPLYAMATEPALV

glyA

Serine hydroxymethyltransferase

429 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

45.756 kDa

MSDSTASSINKGLAAADPAIAALIEKEQQRQETHLELIASENFASRAVMDAQGSVLTNKYAEGLPSKRYYGGCEHVDAIEELAIERAKELFGAAWANVQPHSGAQANFAVFLALLQPGDTIMGLDLSHGGHLTHGSPVNVSGKWFNVVQYGVDRETQRLDMEAIRQLALEHKPKLIVCGFSAYPRTIDFAAFRAIADEVGAFLLADMAHIAGLVAAGVHPSPVPHCDVVTTTTHKTLRGPRGGLILCRDADFAKKFDKAVFPGSQGGPLEHVIAAKAVAFGEALQPAFKTYSQHVVANAAALAERLIARGIDVVSGGTDNHVVLLDLRSVGMTGKVADLLVSDVHITANKNTVPFDPESPFVTSGLRLGTAALTTRGFDAGAFREVADVIADRLLNPEDDAVQQQCLRRVEALCQRFPLYAAARQPALA

glyA

Serine hydroxymethyltransferase

429 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

46.185 kDa

MTDRSAAPINASLKAADPAIAGLIDQEQMRQETHLELIASENFTSKAVMEAQGSVLTNKYAEGLPHKRYYGGCEHVDAIEELAITRAKQLFGAAWANVQPHSGAQANFAVFLALLQPGDTILGMDLSHGGHLTHGSPVNVSGKWFNVVQYGVDKETQRLDMEAIRKLALEHKPKLIICGYSAYPRSIDFAAFRSIADEVGAYLLADMAHIAGLVAAGVHASPVPHCDVVTTTTHKTLRGPRGGLILCRDAEFARRFDKAVFPGSQGGPLEHVIAAKAVAFGEALQPDFKAYSRQVVANAQALAARLQERKIDVVSGGTDNHVVLLDLRSIGMTGKVADLLVSDVHITANKNTVPFDPESPFVTSGLRLGTAALTTRGFDEKAFHEVADVIADRLQNPEDDAIQARCLERVSDLCKRFPLYAPALEPALA

glyA

Serine hydroxymethyltransferase

429 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

46.181 kDa

MSQVSERAINAGLASADPEISRLIDQERHRQETHLELIASENFASQAVMQAQGSVLTNKYAEGLPAKRYYGGCEHVDAIETLAIERAKQLFDAAWANVQPHSGAQANFAVFLALLKPGDTIMGLDLSHGGHLTHGSPVNVSGKWFNVVQYGVDPTTQRLDMEAIRKLALEHKPKLIVCGYSAYPRTIDFAAFRSIADEVGAFLLADMAHIAGLVAAGVHPSPVPHCDVVTTTTHKTLRGPRGGLILCRDAEFAKKFDKAVFPGTQGGPLEHVIAAKAVAFGEALQPSFKTYSQQVVANAGALAEQLISRGINVVSGGTDNHVVLLDLRSIGMTGKVADLLVSDVHITANKNTVPFDPESPFVTSGLRLGTAALTTRGFDVDAFREVADVIADRLHHPEDDAIRQRCLERVSILCSRFPLYADSKEPALV

glyA

Serine hydroxymethyltransferase

429 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

46.384 kDa

MTDRFLASINAALTDSDPAIAGLIDQERQRQETHLELIASENFTSQAVMQAQGSVLTNKYAEGLPHKRYYGGCEHVDAIEELAIERAQRLFGAAWANVQPHSGAQANFAVFLALLQPGDTIMGMDLSHGGHLTHGSPVNVSGKWFKVVHYGVERDSQQLDMEAVRQLALKERPQLIICGYSAYPRTIDFAAFRSIADEVGAYLLADMAHIAGLVAAGVHPSPIAHCDVVTTTTHKTLRGPRGGLILCRDADFGRKFDKAVFPGSQGGPLEHVIAAKAVALGEALQPEFQVYSCQVVANAQVLAGRIQERGIAVVSGGTDNHLVLLDLRSIGMTGKVADLLVSEVNITANKNTVPFDPESPFVTSGLRLGTAALTTRGFDDEAFREVADVIADRLLKPQDESIKAQCLERVRQLCGRFPLYRDVLQPALA

glyA

Serine hydroxymethyltransferase

429 amino acids

Catalyzes the reversible interconversion of serine and glycine with a modified folate serving as the one-carbon carrier. Also exhibits a pteridine-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

47.384 kDa

MLPKELEEIIDVVLVHNNWRRRETINLIASENVMSPLAELVYLNDMAGRYAEGTVGNRYYQGTKYVDLIEDVLTKRFAKALGATYVDVRPVSGTVANLATYFALVPEGGVVASLPVKYGGHISHNTVGGLKALRLKMVELPWDLDRFNIDVDRARKVIEEAKPNLVILGGSLYLFPHPIREIAEIAKASGAYVLHDSAHVFGLIIGGVFPNPLKEGAHVITTSTHKTFPGPQGGLIAAVVEDKVNDLQRAVFPVFTSNYHLHRYAATYVTLVEMEHFGAEYARRVVENARALAEALAEQGVPPVAEALGYTRTHQVAVDVSKFGGGDKVAAKLEEANIIVNKNALPWDKSVLKPSGIRLGVQEMTRFGMGKDEMREIAKFIARVLSGEDPAGVRRDVAEFRKAYLEIKYGFKIDRELVDKVFKSLSLYT

glyA

Serine hydroxymethyltransferase

428 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

47.454 kDa

MEHLLKTDPEVFDAVVKEYERQFYNLEMIASENFTSLAVMEATGSVLTNKYAEGLPGKRYYGGCEYVDVVENLAIERAKKLFGAEHANVQPHSGSQANMAVYFAVLNPGDTIMGMDLAHGGHLTHGAKVNFSGKLYNVIHYGVNPETELIDYDQLYKLAKEHKPKLIVGGASAYPRVFDWAKMREIADEVGALFMVDMAHYAGLIAGGVYPNPVPYAQFVTSTTHKTLRGPRSGFILTTKEYAKAVDKSVFPGIQGGPLMHVIAAKAVAFKEAMSEEFKEYAKQVVENARVLAEELKKYGFKIVTGGTDSHIVLVDLRNKNIIGKDAEKALEKAGITVNKNAVPFDPLPPTKTSGIRIGTAALTTRGMKEDEMRKIAGWINEVLSNMDDEKTIQRVRQEVRELCETFPLYPELKRRIDELRSGKATDL

glyA

Serine hydroxymethyltransferase

428 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

47.454 kDa

MEHLLKTDPEVFDAVVKEYERQFYNLEMIASENFTSLAVMEATGSVLTNKYAEGLPGKRYYGGCEYVDVVENLAIERAKKLFGAEHANVQPHSGSQANMAVYFAVLNPGDTIMGMDLAHGGHLTHGAKVNFSGKLYNVIHYGVNPETELIDYDQLYKLAKEHKPKLIVGGASAYPRVFDWAKMREIADEVGALFMVDMAHYAGLIAGGVYPNPVPYAQFVTSTTHKTLRGPRSGFILTTKEYAKAVDKSVFPGIQGGPLMHVIAAKAVAFKEAMSEEFKEYAKQVVENARVLAEELKKYGFKIVTGGTDSHIVLVDLRNKNIIGKDAEKALEKAGITVNKNAVPFDPLPPTKTSGIRIGTAALTTRGMKEDEMRKIAGWINEVLSNMDDEKTIQRVRQEVRELCETFPLYPELKRRIDELRSGKATDL

glyA

Serine hydroxymethyltransferase

428 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydromethanopterin (H4MPT) serving as the one-carbon carrier. Also exhibits a pteridine-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

46.897 kDa

MFGLEDVHSVVRAVEKHHEWLKKCLPMIASENVTSPAVREMLVTDFGHRYAEGKPGERLYEGCEYIDEVELACVRLAKELFGAEHANVQPTSGVVANLAALFALTEPGDTILGLRISHGGHISHHDISAPGVRGLNVEYLPFDEEDMAIDVDGMVRKIEEVEPSVVMLGASLFLFPHPVEEAVEAVEAVGGYVVYDAAHVLGLIAGGQFQDPIREGAHVVTGSTHKTFPGPQGGIVLCQRDLADDIDEAVFPGLVSNHHLHHVAALAVALAEFKEYGERYARDTVRNAKALAEALYAEGLRVLCEHRGFTESHQIAVDVREQGGGAVIAEKLESANILCNKNLLPWDDESKSHDPSGIRLGTQELTRLGMGLSEMEYIAELIADVVLGRREPSEVRKDVEELRREFQEVKYGFGSGVGAHEWPRLADW

glyA

Serine hydroxymethyltransferase

428 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

47.149 kDa

MNHGVYQNLFIDSLDSVDPQIAEVLDLELRRQRDFLEMIASENFVPRAILQAQGSVLTNKYAEGYPQNRYYGGCECVDLAEDLAISRVRDLFGSEFANVQPHSGSTANAAALMALTEVGSTIMGLELDHGGHLTHGMPLSFSGKHYKAVTYRLDPKTCLIDMDSVRDLALRHRPSVIIAGWSAYVRHLDFEAFRSIADEVGARLWVDMAHFAGLVAAGLYPSPIPWADVVTSTTHKTLAGPRGGFILAKKEFGKAINTAVFPGQQGGPLMHVIAAKAVAFKVAASEGFRERQRITIEAARTVAKRIGEDYRLRDRGIDILTGGTDVHMVLVDMRKSDMDGLTGQNLLHEVGVTVNRNSMPYDKRPPRITSGIRIGTPALVTRGLSLDEFDEVADIISNALLTIDLPKQKQRALRIARTHPVYEGLRQY

glyA

Serine hydroxymethyltransferase

428 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

47.149 kDa

MNHGVYQNLFIDSLDSVDPQIAEVLDLELRRQRDFLEMIASENFVPRAILQAQGSVLTNKYAEGYPQNRYYGGCECVDLAEDLAISRVRDLFGSEFANVQPHSGSTANAAALMALTEVGSTIMGLELDHGGHLTHGMPLSFSGKHYKAVTYRLDPKTCLIDMDSVRDLALRHRPSVIIAGWSAYVRHLDFEAFRSIADEVGARLWVDMAHFAGLVAAGLYPSPIPWADVVTSTTHKTLAGPRGGFILAKKEFGKAINTAVFPGQQGGPLMHVIAAKAVAFKVAASEGFRERQRITIEAARTVAKRIGEDYRLRDRGIDILTGGTDVHMVLVDMRKSDMDGLTGQNLLHEVGVTVNRNSMPYDKRPPRITSGIRIGTPALVTRGLSLDEFDEVADIISNALLTIDLPKQKQRALRIARTHPVYEGLRQY

glyA

Serine hydroxymethyltransferase

427 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

45.736 kDa

MSSAPTDAFFRTPLSERDPEVFAAITQELKRQQDQIELIASENIVSRAVLEAQGSVMTNKYAEGYPGKRYYGGCEFVDIAESLAISRACQIFGCSYANVQPSSGSQANQGVFMALLQPGDTIMGMSLAAGGHLTHGAAPNQSGKWFKAVQYGVRQQDSQIDFAEVEELARTHRPKLIIAGGSAYPRTIDFARFRKIADEVGAFFMVDMAHFAGLVAGGVYPNPLPHAHVVTTTTHKTLRGPRGGMILSNDADIGKKINSAIFPGIQGGPLMHVIAGKAVAFGEALKPEFKLYAKQVVDNARALADTLVRRGLDIVSGGTDSHLMLVDLRPKKLTGKAAEASLEHAGMTCNKNGIPFDPEKPTITSGVRLGTPAATTRGFGVEEFKKVGELIGDVLDGLAANPEDNSAAEARARAEVAELCRRFPIYQ

glyA

Serine hydroxymethyltransferase

427 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

46.272 kDa

MTRTNSDFLTNSDPAIAGLINQELQRQRDHLELIASENFTSAAVLAAQGSVLTNKYAEGLPGKRYYGGCEFIDKIEQIAIDRAKQLFGAAHANVQPHSGAQANFAVFLTLLAPGDKIMGMDLSHGGHLTHGSPVNVSGKWFQVCHYGVSQQTEQLDYDQIRELALRERPKLLICGYSAYPRIIDFEKFRSIADEVGAYLLADIAHIAGLVASGLHPDPIPYCHVVTTTTHKTLRGPRGGLILTGDAELGKKLDKSVFPGSQGGPLEHVIAGKAVAFGEALKPEFQGYSAQVIENARALANQLQNRGLKLVSDGTDNHLMLVDLRSVNMTGKRADQLVSEVNITANKNTVPFDPQSPFVTSGLRLGSPAMTTRGMGEAEFTEIGNIIADRLLNPDSDTVAQDCKRRVAALCDRFPLYPHLEIPVPVLA

glyA

Serine hydroxymethyltransferase

427 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

46.272 kDa

MTRTNSDFLTNSDPAIAGLINQELQRQRDHLELIASENFTSAAVLAAQGSVLTNKYAEGLPGKRYYGGCEFIDKIEQIAIDRAKQLFGAAHANVQPHSGAQANFAVFLTLLAPGDKIMGMDLSHGGHLTHGSPVNVSGKWFQVCHYGVSQQTEQLDYDQIRELALRERPKLLICGYSAYPRIIDFEKFRSIADEVGAYLLADIAHIAGLVASGLHPDPIPYCHVVTTTTHKTLRGPRGGLILTGDAELGKKLDKSVFPGSQGGPLEHVIAGKAVAFGEALKPEFQGYSAQVIENARALANQLQNRGLKLVSDGTDNHLMLVDLRSVNMTGKRADQLVSEVNITANKNTVPFDPQSPFVTSGLRLGSPAMTTRGMGEAEFTEIGNIIADRLLNPDSDTVAQDCKRRVAALCDRFPLYPHLEIPVPVLA

glyA

Serine hydroxymethyltransferase

427 amino acids

Its primary function is to catalyze the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism. Thus, is able to catalyze the cleavage of L-threonine, L-allo-threonine, L-threo-beta-phenylserine and L-erythro-beta-phenylserine. This second activity is likely to be physiological in H.thermophilus, which is an organism that lacks the ortholog gene for the 'real' threonine aldolase characterized in mesophilic bacteria (LtaE), yeast and plants.

Belongs to the SHMT family.

47.535 kDa

MRHLFNTDAEIYEAIVKEYERQFYHLELIASENFTSLAVMEAQGSVMTNKYAEGLPHKRYYGGCEFVDIAEDLAIERAKALFDAEHANVQPHSGTQANMAVYMAVLKPGDTIMGMDLSHGGHLTHGAKVNFSGKIYNAVYYGVHPETHLIDYDQLYRLAKEHKPKLIVGGASAYPRVIDWAKLREIADSVGAYLMVDMAHYAGLIAGGVYPNPVPYAHFVTSTTHKTLRGPRSGFILCKKEFAKDIDKSVFPGIQGGPLMHVIAAKAVAFKEAMSQEFKEYARQVVANARVLAEEFIKEGFKVVSGGTDSHIVLLDLRDTGLTGREVEEALGKANITVNKNAVPFDPLPPVKTSGIRLGTPAMTTRGMKEDQMRIIARLISKVIKNIGDEKVIEYVRQEVIEMCEQFPLYPELREEINHLAKIKATY

glyA

Serine hydroxymethyltransferase

427 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

46.385 kDa

MTDTNLDFLAQTDPTLAAMIQGELQRQREHLELIASENFTSPAVLAAQGSVLTNKYAEGLPKKRYYGGCEWVDQAEQLAIDRAKELFGAAHANVQPHSGAQANFAVFLALLNPGDTIMGMDLSHGGHLTHGSPVNVSGKWFKVSHYGVSPDTERLDYDSILELAKKEKPKLLICGYSAYPRIIEFDKFRAIADEVGAYLMADIAHIAGLVASGHHPNPLPYCDVVTTTTHKTLRGPRGGLIMTNNPELGKQFDKAVFPGTQGGPLEQVIAAKAVAFGEALKPEFKVYSGQVIANAQALANQLNQRGFKLVSGGTDNHLMLVDLRCIDMTGKEADKLVSEINITANKNTVPFDPESPFVTSGLRLGSPAMTTRGLGVEEFREIGNIIADCLLNRNDEAVKKDCLNRVKALCDRFPLYPHLNIPVPVLA

glyA

Serine hydroxymethyltransferase

427 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

46.34 kDa

MTDTNLDFLAMSDPAIAEMIQQELQRQRDHLELIASENFTSAAVLAAQGSVLTNKYAEGLPKKRYYGGCEYIDKVEQLAIDRAKQLFGAAHANVQPHSGAQANFAVFLALLEPGDTIMGMDLSHGGHLTHGSPVNVSGKWFRVVNYGVNRETEQLDYDLIREIALKEQPKLIICGYSAYPRIIQFDKFRAIADEVGAYLLADIAHIAGLVATGHHPSPIPHCHVVTTTTHKTLRGPRGGLILTADAELGKKFDKAVFPGTQGGPLEQVIAGKAVAFGEALKPEFKTYSGQVIANAQALANGLIKRGFKIVSNGTENHLMLVDLRSIGMTGKQADQLVSEVNITANKNTLPFDPESPFVTSGLRLGSPAMTTRGMKEAEFIEIANIIADRLLNPEDEAVKQDVKNRVAALCDRFPLYPHLNIPVAAIA

glyA

Serine hydroxymethyltransferase

427 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

46.284 kDa

MTDTNLDILSLTDPAIAGILQKELQRQRDHLELIASENFTSAAVMAAQGSVLTNKYAEGLPKKRYYGGCEYIDEAEQLAIDRVKRLFGANHANVQPHSGAQANFAVFLTLLQPGDTIMGMDLSHGGHLTHGSPVNVSGKWFRVVQYGVSPESERLDYDLILDIARKEKPKLIICGYSAYSRQIDFEKFRAIADEVGAYLMADIAHIAGLVATGHHPNPLPHCDVVTTTTHKTLRGPRGGLIMTKDEELGKKFDKSVFPGTQGGPLEHVVAAKAVAFGEALKPEFKIYSGQVIANAQALAGQLKARGIKIVTDGTDNHLMLLDLRSVGMTGKEADRLVSTINITANKNTVPFDPESPFVTSGLRLGSPAMTTRGLGETEFIEIGNIIADILLNPGDEALRTACRQRVAKLCESFPLYPHLHISVPALA

glyA

Serine hydroxymethyltransferase

427 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

46.299 kDa

MTRTNSDFLSSTDPAIAELINDELQRQRDHLELIASENFTSAAVLAAQGSVLTNKYAEGLPGKRYYGGCEYIDKIEQLAINRAKQIFGAAHANVQPHSGAQANFAVFLSLLQPGDKIMGMDLSHGGHLTHGSPVNVSGKWFQVSHYGVSQQTEQLDYDQIRELALRERPKLLICGYSAYPRIIDFEKFRSIADEVGAYLLADIAHIAGLVASGLHPDPIPHCHVVTTTTHKTLRGPRGGLILTSDAELGKKLDKSVFPGTQGGPLEHVIAGKAVAFGEALKPEFKTYSAQVIENARALAEQLQNRGLKLVSNGTDNHLLLVDLRSVNLTGKQADQLVSTVNITANKNTIPFDPQSPFVTSGLRLGSPAMTTRGLGVAEFTEIANIISDRLLSPDSDVVTQDCRQRVAALCDRFPLYPHLEIPVPALA

glyA

Serine hydroxymethyltransferase

427 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

46.48 kDa

MTRTNSDFLTNSDPAIAGLINQELQRQRDHLELIASENFTSAAVLAAQGSVLTNKYAEGLPGKRYYGGCEFIDKIEQIAIDRAKQLFGADHANVQPHSGAQANFAVFLTLLKPGDKIMGMDLSHGGHLTHGSPVNVSGKWFQVCHYGVSQQTEQLDYDQIRELALRERPKLLICGYSAYPRIIDFEKFRSIADEVGAYLLADIAHIAGLVATGLHPNPLPYCDVVTTTTHKTLRGPRGGLILTRDAELGKKLDKSVFPGTQGGPLEHVIAGKAVAFGEALKPEFQGYSAQVIDNARTLANQLQTRGLKLVSDGTDNHLMLVDLRSVNMTGKRADQLVSEVNITANKNTVPFDPQSPFVTSGLRLGSPAMTTRGMGEAEFTEIGNIIADRLLNPDSDTVAQDCKRRVAALCDRFPLYPHLEIPVPVLA

glyA

Serine hydroxymethyltransferase

427 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

46.187 kDa

MTETNFDFLAQGDPAIAAIIGRELQRQQEHLELIASENFASPAVMAAQGSVLTNKYAEGLPSKRYYGGCEFVDQAEELAIERAKELFGAAHANVQPHSGAQANFAVFLTLLQPGDTFLGMDLSHGGHLTHGSPVNVSGKWFNAGHYGVNRETERLDYDAIRELALQHRPKLIICGYSAYPRTIDFAKFREIADEVGAYLLADMAHIAGLVAAGLHPSPIPHCDVVTTTTHKTLRGPRGGLILTRDAELGKKLDKSVFPGTQGGPLEHVIAAKAVAFGEALRPEFKTYSAQVIANAQALARQLQARGLKIVSDGTDNHLLLVDLRSIGMTGKVADLLVSDVNITANKNTVPFDPESPFVTSGIRLGTAAMTTRGFKEAEFAIVADIIADRLLNPEDSSMEDSCRRRVLELCQRFPLYPHLSPATPVAV

glyA

Serine hydroxymethyltransferase

427 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

46.206 kDa

MAILAETDPVVYRLIQQELNRQRDHLEMIASENFTSPAVLAAQGSVLTNKYAEGLPGKRYYGGCEFIDEIEQLAIDRAKQLFGAAHANVQPHSGAQANFAVFLALLQPGDTIMGMDLSHGGHLTHGSPVNVSGKWFRVVHYGVHPQTERIDFDQVRDLALQHRPKLIICGYSAYPRAIDFAAFRTIADEVGAYLLADIAHIAGLVATGHHPNPVPLCDVVTTTTHKTLRGPRGGLILTRDPELGKKLDKAVFPGSQGGPLEHVIAGKAVAFGEALQPSFAQYSAQVIANAQALAGSLQRRGIRLVSGGTDNHLMLLDLRSVSAVLEKTGAADPVMTGKRADRLMGKIHITANKNTIPFDPQPPFVASGLRLGSPALTTRGLGPVEFEEIGEIIADCLFQPEEPAVLEECRQRVAQLCRRFPLYPHLG

glyA

Serine hydroxymethyltransferase

427 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

46.187 kDa

MTETNFDFLAQGDPAIAAIIGRELQRQQEHLELIASENFASPAVMAAQGSVLTNKYAEGLPSKRYYGGCEFVDQAEELAIERAKELFGAAHANVQPHSGAQANFAVFLTLLQPGDTFLGMDLSHGGHLTHGSPVNVSGKWFNAGHYGVNRETERLDYDAIRELALQHRPKLIICGYSAYPRTIDFAKFREIADEVGAYLLADMAHIAGLVAAGLHPSPIPHCDVVTTTTHKTLRGPRGGLILTRDAELGKKLDKSVFPGTQGGPLEHVIAAKAVAFGEALRPEFKTYSAQVIANAQALARQLQARGLKIVSDGTDNHLLLVDLRSIGMTGKVADLLVSDVNITANKNTVPFDPESPFVTSGIRLGTAAMTTRGFKEAEFAIVADIIADRLLNPEDSSMEDSCRRRVLELCQRFPLYPHLSPATPVAV

glyA

Serine hydroxymethyltransferase

427 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

45.986 kDa

MNSSPDPLAALTATDPTIADLIRAEERRQSEKIRLIPSENYVSKAVLEATGTVLTNKYSEGYPNRRYYEGQQFIDQIETIAIERAKQLFGVDHANVQPYSGSPANLAIYLALLSPGDTVMGMALPMGGHLTHGWPVSATGIWFRSVQYGVRRDTGRIDFDEVREVARRERPKVIFAGGTAIPRIIDFAAFAEIAREVNAVLVADIAHISGLVAGGVHPSPVGHADIISTTTHKTLRGPRGAMLMSTEQYAKALDKAVFPGLQGGPHNHTTAAIAVALLEAMQPEFRDYARNIVANAAVLAEELLARGFDLVSGGTDNHLILVDLTSKGVAGKPVARALDRAGIELNYNTVPFDPRKPFDPSGIRLGTPAVTSRGMGPAEMRQIAAWIDEVTTAVAKGDEEALAAVEQRVAGEVRELTKNFPTPGLDR

glyA

Serine hydroxymethyltransferase

427 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

46.117 kDa

MSDRMSLSLAQSDPDVAAAIDHEVLRQHEGLEMIASENFVSRAVLEAAGSVFTNKYAEGYPGRRYYGGCEFADVVENLARDRAKQLFGAEHANVQPHSGSQANAAAYMSIIQPGDTILGLDLAHGGHLTHGHKLNFSGKLYRVASYGVRKDTETIDYDELEAIAVREQPKMIIGGGSAYPRIFDFARMRQIADKVGAFLLVDMAHFAGLVAGGAHPSPVPHAHIVTTTTHKTLRGPRSGLILCRQEHAAAVDKSVFPGQQGGPLVHIMAAKAVAFREALQPDFSKYAQQIVDNARALAAALAGHGYRIISGGTDTHLMLIDVFAKGILGSEAEAALGKAGITVNKNAIPYDTNPPLKPSGIRIGTPALTTRGMKEAEMKQIAQWIVSALEHRNNESMLERIHGEVTEMANQFPLYGWLREDAEALAR

glyA

Serine hydroxymethyltransferase

427 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

46.26 kDa

MNQTNLDFLATSDPALAAIIDRELQRQRTHIELIASENFTSAAVMAAQGSVLTNKYAEGLPGKRYYGGCEFVDQAETLAISRVKELFGAAHANVQPHSGAQANFAVFLTLLQPGDTIMGMDLSHGGHLTHGSPVNVSGKWFEVAHYGVEKETGRLDYDKIRQQALEVKPKLLICGYSAYPRQIEFDKFRAIADEVGAYLMADIAHIAGLVASGHHPSPLPYCDVVTTTTHKTLRGPRGGLIMTNNEELGKKFDKSVFPGTQGGPLEHVITAKAVAFGEALKPEFKVYSGQVIANAQAMADQLQKRGFDLVSGGTDNHLMLVDLRSIAMTGKVGDQLLGEINITANKNTVPFDPESPFVTSGLRLGSPAMTTRGMQEDEFRTIANIIADRLLSPEDEGVKADCLRRVSELCAGFPLYDHLRIPVAVIA

glyA

Serine hydroxymethyltransferase

427 amino acids

Catalyzes the reversible interconversion of serine and glycine with a modified folate serving as the one-carbon carrier. Also exhibits a pteridine-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

47.79 kDa

MSYREYRDRVLNFIEDHEHWRAHTINLIASENVTSPSVTRAVASGFMHKYAEGWPRQRYYQGCKYVDEVELIGVELFTKLFGSDFADLRPISGTNANQAAFFGLTQPGDKAIVLHTSHGGHISHMPFGAAGMRGLEVHTWPFDNEAFNIDVDKAEKLIRELEPKIVVFGGSLFPFPHPVKELAPVAKEVGAYVMYDAAHVLGLIAGKQFQDPLREGADIITASTHKTFPGPQGGVILYKKFGETEEIAKLQWAIFPGVLSNHHLHHMAGKVITAAEMLEYGEKYAAQVVKNAKALAEALAEEGFKVIGEDKGYTESHQVIVDVSDLHPAAGGWAAPLLEEAGIILNKNLLPWDPLEKVNEPSGLRIGVQEMTRVGMFEDDMKEIAHFIRRVLIDKEDPKKVRRDVYGFRAEFQKVYYSFDHGLPLRE

glyA

Serine hydroxymethyltransferase

427 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

47.458 kDa

MWKHVKQVDPEIYEVLVNELKRQEYGLELIASENFASLAVIETMGSMLTNKYAEGYPKKRYYGGCEWVDRAEERAIERAKRLFGAKFANVQPHSGSQANMAVYLALAQPGDTIMGMSLSHGGHLTHGAPVNFSGKIFKVVPYGVNLETETIDYDEVRRLALEHKPKIIVAGGSAYARIIDFKRFREIADEVGAYLMVDMAHFAGLVAAGIHPNPLEYAHVVTSTTHKTLRGPRGGLILTNDPEIAKAVDKTIFPGIQGGPLMHVIAAKAVCFKEAMTEEFKEYQKQVVKNAKKMAEEFQKRGYRIVSGGTDTHLFLVDLTPKDITGKAAEKALESCGITVNKNTIPNEKRSPFVASGIRIGTPAVTTRGMKEEEMEEIAEMIDLVLSNVIDENGTVKPEVREEVSKKVRELCERFPLYRDKIEGVEI

glyA

Serine hydroxymethyltransferase

427 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

47.502 kDa

MWEHVKKVDPEIYEVLVNELRRQEYGLELIASENFASLAVIETMGSVLTNKYAEGYPGRRYYGGCEWVDRAEELAIERAKKLFGAEFANVQPHSGSQANMAVYLALAQPGDTIMGMSLSHGGHLTHGAPVNFSGRIFKVVHYGVNLETETIDYDEVRKLALEHRPKIIVAGGSAYARTIDFKRFREIADEVGAYLMVDMAHFAGLVAAGIHPNPVEYAHVVTSTTHKTLRGPRGGLILTNDPEIAKAVDKTIFPGIQGGPLMHVIAAKAVCFKEAMSEEFREYQKQVVKNAKKMAEEMKKRGYRIVSGGTDTHLFLVDLTPKDITGKAAEKALESCGITVNKNTIPNEKRSPFVASGIRIGTPAVTTRGMKEKEMEEIVELIDYVLSSITDEKGTVRPEVREEVTRRVRKLCEMFPLYRDKIEGVEI

glyA

Serine hydroxymethyltransferase

427 amino acids

Catalyzes the reversible interconversion of serine and glycine with a modified folate serving as the one-carbon carrier. Also exhibits a pteridine-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

47.746 kDa

MENGYKTYRDKVIEYLEAHEKWRSSTINLIASENVTSPSVNRAVSSGFMHKYAEGWPRQRYYQGCKYVDEVELIGVDLFCKLFGSDFADLRPISGTNANQAVFFGLTQPGDKAIVLHTSHGGHISHMPFGAAGMRGLEVHTWPFDNEEFNIDVDKAAQLIRELEPRIVVFGGSLFPFPHPVKELAPVAKEVGAYVMYDAAHVLGLIAGKQFQNPLREGVDIMTASTHKTFPGPQGGIILYKNFGDDVAKLQWAIFPGVLSNHHLHHMAGKVITAAEMLEFGERYAAQIVKNAKALAEALAEEGFKVIGEDKDYTESHQVIVDVSDLHEAAGGWAAPLLEEAGIILNKNLLPWDPLEKVNTPSGLRIGVQEMTRVGMLEDNMKDIAVFMRRVLIDKEDPKKVEKEVAEYRKEYQKVYYSFDHGLPMKE

glyA

Serine hydroxymethyltransferase

427 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

47.416 kDa

MWKHVKQVDPEIYEVLVNELKRQEYGLELIASENFASLAVIETMGSMLTNKYAEGYPQKRYYGGCEWVDRAEELAIERAKRLFGAKFANVQPHSGSQANMAVYLALAQPGDTIMGMSLSHGGHLTHGAPVNFSGKIFKVVPYGVNLETETIDYDEVRRLALEHKPKIIVAGGSAYARIIDFKRFREIADEVGAYLMVDMAHFAGLVAAGIHPNPLEYAHVVTSTTHKTLRGPRGGLILTNDPDIAKAVDKTIFPGIQGGPLMHVIAAKAVCFKEAMTEEFKEYQKQVVKNAKKMAEEFQKRGYRIVSGGTDTHLFLVDLTPKDITGKAAEKALESCGITVNKNTIPNEKRSPFVASGIRIGTPAVTTRGMKEEEMEEIAEMIDLVLSNVTDENGTVKPEVREEVSKRVRELCERFPLYRDKIEGVEI

glyA

Serine hydroxymethyltransferase

427 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

47.402 kDa

MWKHVKQVDPEIYEVLVNELKRQEYGLELIASENFASLAVIETMGSMLTNKYAEGYPQKRYYGGCEWVDRAEELAIERAKRLFGAKFANVQPHSGSQANMAVYLALAQPGDTIMGMSLSHGGHLTHGAPVNFSGKIFKVVPYGVNLETETIDYDEVRRLALEHKPKIIVAGGSAYARIIDFKRFREIADEVGAYLMVDMAHFAGLVAAGIHPNPLEYAHVVTSTTHKTLRGPRGGLILTNDPDIAKAVDKTIFPGIQGGPLMHVIAAKAVCFKEAMTEEFKEYQNQVVKNAKKMAEEFQKRGYRIVSGGTDTHLFLVDLTPKDITGKAAEKALESCGITVNKNTIPNEKRSPFVASGIRIGTPAVTTRGMKEEEMEEIAEMIDLVLSNVTDENGTVKPEVREEVSKRVRELCERFPLYRDKIEGVEI

glyA

Serine hydroxymethyltransferase

427 amino acids

Catalyzes the reversible interconversion of serine and glycine with a modified folate serving as the one-carbon carrier. Also exhibits a pteridine-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

47.947 kDa

MAYKEYRDKVLHFIEEHEKWRSHTINLIASENITSPSVNRAVASGFMHKYAEGWPRQRYYQGCKYVDEVELIGVELFTKLFKSDYADLRPISGTNANQAVFFGLGQPGDKVIVLHTSHGGHISHMPFGAAGMRGLEVHTWPFDNESFNIDVDKAEKMIRELEPKIVVFGGSLFPFPHPVKELAPVAKEVGAFVVYDAAHVLGLIAGGEFQDPLREGADIMTASTHKTFPGPQGGVILYKKFADDETIAKLQWAIFPGVLSNHHLHHMAGKVITAAEMLEYGEAYAKQIVKNAKALAEALAEEGFKVIGEDQGYTKSHQVIVDVSDLHPAGGGWAAPLLEEAGIILNKNLLPWDPLEKVNEPSGLRIGVQEMTRVGMMEDEMKEIAHFMKRVLLDKEDPKKVRKDVYYFRLEYQKVYYSFDYGLPMKE

glyA

Serine hydroxymethyltransferase

427 amino acids

Catalyzes the reversible interconversion of serine and glycine with a modified folate serving as the one-carbon carrier. Also exhibits a pteridine-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

47.987 kDa

MTYKEYRDKVLNFIEEHEKWRSHTINLIASENITSPSVNRAVASGFMHKYAEGWPKQRYYQGCKYVDEVELIGVELFTKLFKSDYADLRPISGTNANQAVFFGLGQPGDKVIVLHTSHGGHISHMPFGAAGMRGLEVHTWPFDFESFNIDVDKAEKMIRELEPKIVMFGGSLFPFPHPVKELAPVAKEVGAFVVYDAAHVLGLIAGGEFQDPLREGADIMTASTHKTFPGPQGGVILYKKFADDETIAKLQWAIFPGVVSNHHLHHMAGKVITAAEMLEYGEAYAKQIVKNAKALAEALAEEGFKVIGEDQGYTKSHQVIVDVSDLHPAGGGWAAPLLEEAGIILNKNLLPWDPLEKVNEPSGLRIGVQEMTRVGMMEDEMREIAHFIKRVLIDKEDPKKVRKDVYYFRLEYQKVYYSFDYGLPMKE

glyA

Serine hydroxymethyltransferase

427 amino acids

Catalyzes the reversible interconversion of serine and glycine with a modified folate serving as the one-carbon carrier. Also exhibits a pteridine-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

47.982 kDa

MTYREYRDKVLHFIEEHEKWRSHTINLIASENITSPSVNRAVASGFMHKYAEGWPKQRYYQGCKYVDEVELIGVELFTKLFKSDYADLRPVSGTNANQAVFFGLGQPGDKVIVLHTSHGGHISHMPFGAAGMRGLEVHTWPFDFESFNIDVDKAEKMIRELEPKIVVFGGSLFPFPHPVKELAPVAKEVGAFVVYDAAHVLGLIAGGEFQDPLREGADIMTASTHKTFPGPQGGVILYKKFADDETIAKLQWAIFPGVVSNHHLHHMAGKVITAAEMLEYGEAYAKQIVKNAKALAEALAEEGFKVIGEDQGYTKSHQVIVDVSDLHPAGGGWAAPLLEEAGIILNKNLLPWDPLEKVNEPSGLRIGVQEMTRVGMMEDEMKEIAHFMKRVLIDKEDPKKVRKDVYYFRLEYQKVYYSFDYGLPMKE

glyA

Serine hydroxymethyltransferase

426 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

46.307 kDa

MQTSLDILTETDPAIAGILQQELQRQRDHLELIASENFTSAAVLAAQGSVLTNKYAEGLPGKRYYGGCEYIDAAEQLAIDRAKELFGAAHVNVQPHSGAQANFAVFLTLLQPGDTFMGMDLSHGGHLTHGSPVNVSGKWFNVVQYGVDPNSEQLNYDTIRELALKHRPKMIVCGYSAYPRIIDFEKFRAIADEIDAYLMADIAHIAGLVASGHHPNPLPFCDVVTTTTHKTLRGPRGGLIMTKDLELGKKFDKSVFPGTQGGPLEHVIAAKAVAFGEALKPDFRDYCGHVVENAQTLAQQLQERGFKIVSNGTDNHLLLVDLRSIGMTGKQADQRVSQVNITANKNTVPFDPESPFVTSGLRLGSPAMTTRGMGTAEFTEIANIIADCLLKPEDAAVTEDCRQRVANLCSRFPLYPHLTSPVPALT

glyA

Serine hydroxymethyltransferase

426 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

46.431 kDa

MTESQRMSRTLAEVDPEIYQAIQHETARQDGQLELIASENFTSEAVLEATGSVFTNKYAEGYPGKRYYGGCEYTDVVENLARERASKLFGAEYVNVQPHSGSQANQAAYGAVVSPGDTVMGLNLAHGGHLTHGHALNFSGKTYKIVPYNVRKEDELIDYDEVEKLAREHQPKMIIAGASAYPRIIDFARFRKIADAVGAVFLVDMAHISGLVAAGVHPNPCEFADIVTSTTHKTLRGPRAGIILAREKYGKEIDKNVFPGTQGGPLVHVMAAKAVCFLEALQPEFAVYQRQVVANAKALAQSLIDAGFRVVSGGTDTHVVLLDVFSKGLRGKESEQALDRARITVNKNAIPFDTNPPMNPSGIRLGSPAVTTRGFKEAEMREVGTLIAEVLTNIANEDVIAGVRQKVQALTTRFPLYSWKRDTVQA

glyA

Serine hydroxymethyltransferase

426 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

47.218 kDa

MKKDELIFKLIEQENNRQCEGIELIASENFVSPQVLKAAGSILTNKYAEGYPRKRYYGGCQIVDEIEQTAIDRLKHLFHAEWVNVQPHSGAQANMTVFLACLQPGDYFLGLGLSHGGHLSHGSPVNFSGLSYKALEYGTEKENGKINYQQLEYVAMEKIPKLIIAGASAYSRDWDYQRIRLIADKIGAIFMVDMAHPAGLIAAQLLDNPLHYAHIVTSTTHKTLRGPRGGIILMGKDFENPWGRTTTKGKIKMMSEILDSALFPGVQGGPLEHIIAAKAIAFYEALQPEYVVYQKQVKKNAQVMAKALNSTGYKIVSGGTDNHLMLVDLRSKFPTLSGKQAEVALVSADITVNKNMVPFDNRSPFLTSGLRFGTPAITTRGAKEPLMEEIVELIDTVLSNVDNDKIVSSVKKKVNILMKDYPLFAW

glyA

Serine hydroxymethyltransferase

426 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

45.225 kDa

MVAPLAEVDPDIAELLGKELGRQRDTLEMIASENFVPRSVLQAQGSVLTNKYAEGLPGRRYYDGCEHVDVVENIARDRAKALFGADFANVQPHSGAQANAAVLHALMSPGERLLGLDLANGGHLTHGMRLNFSGKLYETGFYGVDATTHLIDMDAVRAKALEFRPKVLIAGWSAYPRILDFAAFRSIADEVGAKLWVDMAHFAGLVAVGLHPSPVPHADVVSTTVHKTLGGGRSGLILGKQEFATAINSAVFPGQQGGPLMHVIAGKAVALKIATTPEFTDRQQRTLAGARILADRLTAADVTKAGVSVVSGGTDVHLVLVDLRNSPFDGQAAEDLLHEVGITVNRNVVPNDPRPPMVTSGLRIGTPALATRGFGEAEFTEVADIIATVLTTGGSVDVAALRQQVTRLARDFPLYGGLEDWSLAGR

glyA

Serine hydroxymethyltransferase

426 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

45.225 kDa

MVAPLAEVDPDIAELLGKELGRQRDTLEMIASENFVPRSVLQAQGSVLTNKYAEGLPGRRYYDGCEHVDVVENIARDRAKALFGADFANVQPHSGAQANAAVLHALMSPGERLLGLDLANGGHLTHGMRLNFSGKLYETGFYGVDATTHLIDMDAVRAKALEFRPKVLIAGWSAYPRILDFAAFRSIADEVGAKLWVDMAHFAGLVAVGLHPSPVPHADVVSTTVHKTLGGGRSGLILGKQEFATAINSAVFPGQQGGPLMHVIAGKAVALKIATTPEFTDRQQRTLAGARILADRLTAADVTKAGVSVVSGGTDVHLVLVDLRNSPFDGQAAEDLLHEVGITVNRNVVPNDPRPPMVTSGLRIGTPALATRGFGEAEFTEVADIIATVLTTGGSVDVAALRQQVTRLARDFPLYGGLEDWSLAGR

glyA

Serine hydroxymethyltransferase

426 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

44.955 kDa

MSAPLADIDPDIAGLLGQELGRQRDTLEMIASENFVPRAVLQAQGSVLTNKYAEGLPGRRYYGGCEYVDVVENIARDRAKALFDADFANVQPHSGAQANAAVLHALMTPGERLLGLDLANGGHLTHGMKLNFSGKLYDVGFYGVDPTTHLIDMDAVRAKALEFRPKVIIAGWSAYPRVLDFAAFASIADEVGAKLWVDMAHFAGLVAAGLHPSPVPHADVVSTTVHKTLGGPRSGLILGKQEYAKSINSAVFPGQQGGPLMHVIAAKAVALKIAGTEEFADRQRRTLSGARILAERLSGADVAAAGVSVVSGGTDVHLVLVDLRNSELDGQAAEDLLHEIGITVNRNAVPNDPRPPMVTSGLRVGTPALATRGFGGAEFSEVADVIATALAGGRGADLAALRDRVTRLARDFPLYEGLEDWALVGR

glyA

Serine hydroxymethyltransferase

426 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

47.218 kDa

MKKDELIFKLIEQENNRQCEGIELIASENFVSPQVLKAAGSILTNKYAEGYPRKRYYGGCQIVDEIEQTAIDRLKHLFHAEWVNVQPHSGAQANMTVFLACLQPGDYFLGLGLSHGGHLSHGSPVNFSGLSYKALEYGTEKENGKINYQQLEYVAMEKIPKLIIAGASAYSRDWDYQRIRLIADKIGAIFMVDMAHPAGLIAAQLLDNPLHYAHIVTSTTHKTLRGPRGGIILMGKDFENPWGRTTTKGKIKMMSEILDSALFPGVQGGPLEHIIAAKAIAFYEALQPEYVVYQKQVKKNAQVMAKALNSTGYKIVSGGTDNHLMLVDLRSKFPTLSGKQAEVALVSADITVNKNMVPFDNRSPFLTSGLRFGTPAITTRGAKEPLMEEIVELIDTVLSNVDNDKIVSSVKKKVNILMKDYPLFAW

glyA

Serine hydroxymethyltransferase

426 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

45.225 kDa

MVAPLAEVDPDIAELLGKELGRQRDTLEMIASENFVPRSVLQAQGSVLTNKYAEGLPGRRYYDGCEHVDVVENIARDRAKALFGADFANVQPHSGAQANAAVLHALMSPGERLLGLDLANGGHLTHGMRLNFSGKLYETGFYGVDATTHLIDMDAVRAKALEFRPKVLIAGWSAYPRILDFAAFRSIADEVGAKLWVDMAHFAGLVAVGLHPSPVPHADVVSTTVHKTLGGGRSGLILGKQEFATAINSAVFPGQQGGPLMHVIAGKAVALKIATTPEFTDRQQRTLAGARILADRLTAADVTKAGVSVVSGGTDVHLVLVDLRNSPFDGQAAEDLLHEVGITVNRNVVPNDPRPPMVTSGLRIGTPALATRGFGEAEFTEVADIIATVLTTGGSVDVAALRQQVTRLARDFPLYGGLEDWSLAGR

glyA

Serine hydroxymethyltransferase

426 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

45.225 kDa

MVAPLAEVDPDIAELLGKELGRQRDTLEMIASENFVPRSVLQAQGSVLTNKYAEGLPGRRYYDGCEHVDVVENIARDRAKALFGADFANVQPHSGAQANAAVLHALMSPGERLLGLDLANGGHLTHGMRLNFSGKLYETGFYGVDATTHLIDMDAVRAKALEFRPKVLIAGWSAYPRILDFAAFRSIADEVGAKLWVDMAHFAGLVAVGLHPSPVPHADVVSTTVHKTLGGGRSGLILGKQEFATAINSAVFPGQQGGPLMHVIAGKAVALKIATTPEFTDRQQRTLAGARILADRLTAADVTKAGVSVVSGGTDVHLVLVDLRNSPFDGQAAEDLLHEVGITVNRNVVPNDPRPPMVTSGLRIGTPALATRGFGEAEFTEVADIIATVLTTGGSVDVAALRQQVTRLARDFPLYGGLEDWSLAGR

glyA

Serine hydroxymethyltransferase

426 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

44.955 kDa

MSAPLADIDPDIAGLLGQELGRQRDTLEMIASENFVPRAVLQAQGSVLTNKYAEGLPGRRYYGGCEYVDVVENIARDRAKALFDADFANVQPHSGAQANAAVLHALMTPGERLLGLDLANGGHLTHGMKLNFSGKLYDVGFYGVDPTTHLIDMDAVRAKALEFRPKVIIAGWSAYPRVLDFAAFASIADEVGAKLWVDMAHFAGLVAAGLHPSPVPHADVVSTTVHKTLGGPRSGLILGKQEYAKSINSAVFPGQQGGPLMHVIAAKAVALKIAGTEEFADRQRRTLSGARILAERLSGADVAAAGVSVVSGGTDVHLVLVDLRNSELDGQAAEDLLHEIGITVNRNAVPNDPRPPMVTSGLRVGTPALATRGFGGAEFSEVADVIATALAGGRGADLAALRDRVTRLARDFPLYEGLEDWALVGR

glyA

Serine hydroxymethyltransferase

426 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

46.264 kDa

MSNRMSQSLNEEDPQIAEAIANEERRQHEGLELIASENFVSEAVLQAAGSVFTNKYAEGYPGKRYYGGCEYADVVENLARDRAKELFGAEHANVQPHSGSSANMEAYGAILQPGDTILGLNLAHGGHLTHGHPLNFSGKTYKIVPYGVTKETETIDYDELEKLALEHHPKVIVGGGSAYPRIFDFKRMREIADKAGALFMVDMAHFAGLVAGGAHPSPVPHAHVVTTTTHKTLRGPRAGMILSKQEFAAAIDKVTFPGMQGGPLVHIIAAKAVCFKEAMEPSFKDYANQVVANAKVLAQSLADQGFRIISGGTDTHLMLIDVFAAGMLGSEAEKALGEAGITVNKNAIPFDTNPPMKPSGVRIGTPALTTRGMKEPEMRQVGIWIAESLRHRTDPDFLGRVRRQVHELCDAYPLYPERRATRLATV

glyA

Serine hydroxymethyltransferase

426 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

46.515 kDa

MTRTNLDFLTETDPAIAGLLQQELQRQQDHLELIASENFTSAAVLAAQGSVLTNKYAEGLPGKRYYGGCEYIDKVEQLAIDRAKDLFQAAHANVQPHSGAQANFAVFLALLQPGDTIMGMDLSHGGHLTHGSPVNVSGKWFRVVHYGVDPVTEQLDYEKIRQLAHQHRPKLIICGYSAYPRIIQFDQFRAIADEVGAYLLADMAHIAGLVATGHHPSPIPVCDVVTTTTHKTLRGPRGGLILTRDPELGKKLDKAVFPGNQGGPLEHVIAAKAVAFGEALRPEFKTYSAQVIKNAQALSQQLQQRGFKIVSNGTDNHLLLVDLRSIGMTGKLADQLVSEVNITANKNTVPFDPESPFVTSGLRLGSAAMTTRGMGTPEFIEIANIIADRLLNPEDLAIVQECRQRVAQLCDRFPLYPHLSRVPVLS

glyA

Serine hydroxymethyltransferase

426 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

44.955 kDa

MSAPLADIDPDIAGLLGQELGRQRDTLEMIASENFVPRAVLQAQGSVLTNKYAEGLPGRRYYGGCEYVDVVENIARDRAKALFGADFANVQPHSGAQANAAVLHALMTPGERLLGLDLANGGHLTHGMKLNFSGKLYDVGFYGVDPTTHLIDMDAVRAKALEFRPKVIIAGWSAYPRVLDFAAFASIADEVGAKLWVDMAHFAGLVAAGLHPSPVPHADVVSTTVHKTLGGPRSGLILGKQEYAKSINSAVFPGQQGGPLMHVIAAKAVALKIAGTEEFADRQRRTLSGARILAERLSGADVAAAGVSVVSGGTDVHLVLVDLRNSELDGQAAEDLLHEIGITVNRNAVPNDPRPPMVTSGLRVGTPALATRGFGDAEFSEVADVIATALAGGRGADLAALRDRVTRLARDFPLYEGLEDWALVGR

glyA

Serine hydroxymethyltransferase

426 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

46.674 kDa

MKKDSVIFDLIEKEHQRQLKGIELIASENFVSEQVMQAMGSCMTNKYAEGYPGKRYYGGCEVVDQSEQIAIDRIKQLYGAEWANVQPHSGAQANMAVLLACLEAGDTFMGLNLEHGGHLSHGSLVNSSGILYRPIGYNLSEETGMVDYDHMEKMAIEHKPKLIIGGGSAYSREWDYKRMREIADKVGALLMIDMAHPAGLIAAGLLENPVKYAHIVTSTTHKTLRGPRGGIILMGKDFDNPWGKKTPKGEIKKMSALLDSAVFPGVQGGPLEHVIAAKAVAFGEALDPSFKEYQTQVKKNAAVLAQAFMDKGYKVISGGTDNHSMLIDLRPKFPELTGKVAEKALVAADITVNKNMVPFDSRSAFQTSGFRVGTPAITTRGVKEDKMGYIVELIDRVLSAPEDEAVIASVRTEVNRMMADYPLFAW

glyA

Serine hydroxymethyltransferase

426 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

46.674 kDa

MKKDSVIFDLIEKEHQRQLKGIELIASENFVSEQVMQAMGSCMTNKYAEGYPGKRYYGGCEVVDQSEQIAIDRIKQLYGAEWANVQPHSGAQANMAVLLACLEAGDTFMGLNLEHGGHLSHGSLVNSSGILYRPIGYNLSEETGMVDYDHMEKMAIEHKPKLIIGGGSAYSREWDYKRMREIADKVGALLMIDMAHPAGLIAAGLLENPVKYAHIVTSTTHKTLRGPRGGIILMGKDFDNPWGKKTPKGEIKKMSALLDSAVFPGVQGGPLEHVIAAKAVAFGEALDPSFKEYQTQVKKNAAVLAQAFMDKGYKVISGGTDNHSMLIDLRPKFPELTGKVAEKALVAADITVNKNMVPFDSRSAFQTSGFRVGTPAITTRGVKEDKMGYIVELIDRVLSAPEDEAVIASVRTEVNRMMADYPLFAW

glyA

Serine hydroxymethyltransferase

426 amino acids

Catalyzes the reversible interconversion of serine and glycine with a modified folate serving as the one-carbon carrier. Also exhibits a pteridine-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

46.975 kDa

MSYEDAEYIREMAMKHSEMFGEGIALIASENVMSPLAKEVMISDLESRYAEGLPHHRYYQGNYYVDLIEDRTNELLSKLFRTSQTDPRPISGTNANSAAIYALAGPGDLVATPSLSGGGHISAAEFGILGMRSVRTINYPYDMDTMTIDPDQASKMIIKEKPKVCLFGQSVFMFPAPLKEMAEAFHEVGCKVWYDGAHVLGLIAGGRFQDPLREGADIVTGSTHKTFPGPQHGVILGNTDDETWKAVRRAVFPGVLSNHHLNAMAALGITAAEELEFGKRYADDIISNAKVLAEELYANGFNVLAEKRGFTESHTMAVDVSKNGGGKYVAETLEKCGIILNKNLLPWDDNKKSQNPSGIRIGVQEATRVGMGKSEMKEIASLITRAIIRHEDPEKIKAEVKQLKSGFREVKYCYGKMDGYSYIKLI

glyA

Serine hydroxymethyltransferase

426 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

46.241 kDa

MDERLWEWDFEVAEAIACEERRQSRTIELIASENFTSPAVLAAVGSVLTNKYAEGYPGRRYYGGCECVDRVEELAIQRAKQLFGAPHVNVQPHSGAQANMAAYFAVLQPGDRILGMSLQHGGHLTHGAKVNLSGRWFEVAFYGVDPETERIDYDAVWHIAREIRPKLIISGASAYPRVIDFARLREIADDVGAILMADIAHIAGLVAVGLHPSPIGVAQLVTTTTHKTLRGSRGGMIMCDAEFAEAVDKAVFPGTQGGPLMHVIAGKAVALGEALRPTFRTYIERVLENARVLAETLQAEGFRLVSGGTDNHLLLVDLRSHGLSGRKAERVLDEVGITVNKNTIPNDPKPPTQASGIRLGTPAMTTRGFGPDEMRLTARWIADVLRAPDDESVKARVRAEVAELVSRFPVPGVTIEARTGVDDGTV

glyA

Serine hydroxymethyltransferase

426 amino acids

Catalyzes the reversible interconversion of serine and glycine with a modified folate serving as the one-carbon carrier. Also exhibits a pteridine-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

46.751 kDa

MAYQDALSIRELAQQHNALFGDSVALIASENVMSPLAREVMISDLESRYAEGLPHHRYYQGNNFVDLIEDKTNELLSKLFKTEQTDPRPISGTNANSAAIYALAKPGDLVAVPALSGGGHISAAEFGILGMRGVRTISYPYDKNTMTVDPDEASKIIKREKPKVCLFGQSVFMFPVPLKEMKGAFDEVGCKVWYDGAHVLGLIAGRKFQDPLREGADIVTGSTHKTFPGPQHGVILGNTDSETWKSVRRAVFPGVLSNHHLNAMAALGITAAEELEFGEKYASDIIDNAKALAGELYSLGFKVLAEERGFTESHTMAVDVTQNGGGKYVAETLEASGIILNKNLLPWDDNKKSQNPSGIRIGVQEVTRTGMGKSEMKEIASLIYRAIVKKEEPSKIKEEVKDLKSSFRHVKYCYGDVDAYEYIKLI

glyA

Serine hydroxymethyltransferase

426 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

46.858 kDa

MKRDDLIFDIIEKEHQRQLKGIELIASENFVSDQVMEAMGSCLTNKYAEGYPGKRYYGGCEVVDQSEQIAIDRLKEIFGAEWANVQPHSGAQANAAVFLAVLNPGDKFMGLNLAHGGHLSHGSLVNTSGIIYTPCEYNLKQETGRVDYDQMEEVALREKPKMIIGGGSAYSREWDYKRMREIADKVGAILMIDMAHPAGLIAAGLLDNPVKYAHIVTSTTHKTLRGPRGGVIMMGKDFPNPWGKKTPKGEIKMMSQLLDSAVFPGIQGGPLEHVIAAKAVAFGECLQPEYKEYQKQVQKNAAVLAQALIDRGFTIVSGGTDNHSMLVDLRSKYPTLTGKVAEKALVSADITVNKNMVPFDSRSAFQTSGIRLGTPAITTRGAKEDLMLEIAEMIETVLSNVENEEVIAQVRARVNKTMEKYPIFAY

glyA

Serine hydroxymethyltransferase

426 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

46.858 kDa

MKRDDLIFDIIEKEHQRQLKGIELIASENFVSDQVMEAMGSCLTNKYAEGYPGKRYYGGCEVVDQSEQIAIDRLKEIFGAEWANVQPHSGAQANAAVFLAVLNPGDKFMGLNLAHGGHLSHGSLVNTSGIIYTPCEYNLKQETGRVDYDQMEEVALREKPKMIIGGGSAYSREWDYKRMREIADKVGAILMIDMAHPAGLIAAGLLDNPVKYAHIVTSTTHKTLRGPRGGVIMMGKDFPNPWGKKTPKGEIKMMSQLLDSAVFPGIQGGPLEHVIAAKAVAFGECLQPEYKEYQKQVQKNAAVLAQALIDRGFTIVSGGTDNHSMLVDLRSKYPTLTGKVAEKALVSADITVNKNMVPFDSRSAFQTSGIRLGTPAITTRGAKEDLMLEIAEMIETVLSNVENEEVIAQVRARVNKTMEKYPIFAY

glyA

Serine hydroxymethyltransferase

426 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

46.776 kDa

MKRDDLIFDIIEKEHQRQLKGIELIASENFVSDQVMQAMGSCLTNKYAEGYPGKRYYGGCEVVDQSEQIAIDRLKEIFGAEWANVQPHSGAQANAAVFLAVLNPGDKFMGLNLAHGGHLSHGSLVNTSGIIYTPCEYNLNQETGRVDYDQMEEVALREKPKMIIGGGSAYSREWDYKRMREIADKVGAILMIDMAHPAGLIAAGLLENPVKYAHIVTSTTHKTLRGPRGGVIMMGKDFPNPWGKKTPKGEIKMMSQLLDSAVFPGVQGGPLEHVIAAKAVAFGEILQPEYKEYAKQVQKNAAILAQALIDRGFTIVSGGTDNHSMLVDLRSKYPDLTGKVAEKALVSADITVNKNMVPFDSRSAFQTSGIRLGTPAITTRGAKEDLMIEIAEMIETVLSNVENEEVIAQVRARVNETMKKYPLFAD

glyA

Serine hydroxymethyltransferase

426 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

46.827 kDa

MKRDDLIFDIIEKEHQRQLKGIELIASENFVSDQVMQAMGSCLTNKYAEGYPGKRYYGGCEVVDQSEQIAIDRLKQIFGAEWANVQPHSGAQANAAVFLAVLNPGDKFMGLNLAHGGHLSHGSLVNTSGIIYTPCEYNLNKETGRVDYDQMEEIALREKPKMIIGGGSAYSREWDYKRMREIADKVGAILMIDMAHPAGLIAAGLLDNPVKYAHIVTSTTHKTLRGPRGGVIMMGKDFPNPWGKKTPKGEIKMMSQLLDSAVFPGIQGGPLEHVIAAKAVAFGECLQPEYKEYQTQVKKNAAVLAQALIDRGFTIVSGGTDNHSMLVDLRTKYPDLTGKVAEKALVAADITVNKNMVPFDSRSAFQTSGIRLGTPAITTRGAKEDLMLEIAEMIETVLSNVDNEEVIAQVRARVNETMKKYPIFAY

glyA

Serine hydroxymethyltransferase

426 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

45.703 kDa

MPVSDDLLRATDPLVAGWIDRELNRQRSHLELIASENFTSAAVMAAQGSVLTNKYAEGLPSKRYYGGCEFVDAVEQIAIDRAKALFGAAHANVQPHSGAQANAAVFLALLERGDKILGMDLSHGGHLTHGSPVNQSGIYFEALHYGVDPASHRIDFDQVRELAHAHRPKLIICGYSAYPRVIDFECFREIADEVGAYLLADIAHIAGLVVAGVHPNPIPHCDVVTTTTHKTLRGPRGGLILTRDEALGKRFDKAVFPGTQGGPLEHVIAAKAVAFGEALQPEFKTYAADVVANARALAERLTARGLTLVSGGTDNHLMLVDLRSVDLTGKQADLLMSDVNITTNKNTIPFDPQSPFVTSGLRLGSPAMTTRGLGTTEFGEIGEIIANRLTQPTDARVVADCLERVASLCTRFALYPHLGRVVAPVG

glyA

Serine hydroxymethyltransferase

425 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

45.124 kDa

MPVDQSFNAPLSEVDPEIAAVLEQELGRQRGTLEMIASENFVPRAVLQSQGSVLTNKYAEGYPGRRYYGGCEFVDVAEQLAIDRAKSLFGAEFANVQPHSGATANAAVLAAIAQPGDTILGLELAHGGHLTHGMKLNFSGKLYDAAAYGVDPDTFLIDMDVVREKALEHRPQVIIAGWSAYPRHLDFAAFRSIADEVGAKLWVDMAHFAGLVAAGVHPSPVPYADVVSSTVHKTLAGPRSGVILSRDTALAKKLNSAVFPGQQGGPLMHVIAAKATAFKIAATEEFADRQRRTIQGAQILAERLVAADSTEAGVSVLTGGTDVHLVLADLRNSPIDGKQAEDALHEVGITVNRNSVPFDPRPPMVTSGVRIGTSALATRGFGETEFTEVADIIAETLKPGSDLAALRARVLTLTDGFPLYEGLTQ

glyA

Serine hydroxymethyltransferase

425 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

45.756 kDa

MANTEAFFSQTLAERDPELFATITEEQERQETGIELIASENITSKAVLEAQGSVLTNKYAEGYPHRRYYGGCEAVDVTEQLAIDRAKKLFNCEFVNVQPHSGAQANGAVMLALLQPGDTIMGMSLSSGGHLTHGAAPAQSGKWFNAVQYEVSPETLLIDYDAIEAQALECKPKMIIAGGSAIPRQIDFKRFREIADKVGAYLFVDMAHIAGLVATGVHPSPLPHAHVVTTTTHKTLRGPRGGMILSNDLDLGKKINSAVFPGYQGGPLMHVIAGKAVAFGEALKPEFTDYIKQVVANAKALAEVMVERGCDIVTGGTDTHLMLVDLRPKGLKGNAADAALERAGITCNKNGIPFDTEKPMVTSGIRLGTPAATSRGFGIEEFQKVGHLISDVLDGLVEMPEGNPEVEARVLAEVRELCKRFPLYR

glyA

Serine hydroxymethyltransferase

425 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

45.575 kDa

MVGYIGDIHISESDAEVAECLSAEYKRQNTSLQMIASENFVSRAVLQAQGSVLTNKYAEGYPGSRYYCGCSEVDVAETLAVERLCKLFGCKYANVQPHSGSQANQQVYMALLKPGDTVLGMSLDSGGHLTHGAGPNVSGKWFNAVPYNVRRDTNLLDMGEIEEIALRVKPNLIIAGASSYPRRIDFKAFRAIADKVGAYFLADIAHYSGLIAGGQYPTPFGYAHVVTSTTHKTLRGPRGGVIMTDDEEIHKKLRSAVFPGMQGGALMHVIAAKAVAFREAMSPDFKVYVSQILDNSRALAAVLATGGLDVVTGGTDSHMVVVDLRSKGLTGRDVSSSLERAGIVCNKNAVPFDTEKPWVTSGIRLGAAAETSRGLVVKDFEKIGQLVLKIVDSMRAGADMSVVESGVREEVATLVRVVPYDTLAC

glyA

Serine hydroxymethyltransferase

425 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

46.231 kDa

MPDNNLEILFQHDPAMAEIIQGELQRQRDHLELIASENFTSEAVLAAQGSVLTNKYAEGLPKKRYYGGCEYIDRAEQLAIDRAKELFGAAHANVQPHSGAQANFAVFLALLSPGDTIMGMDLSHGGHLTHGSPVNVSGKWFKVCHYGVNPDTERLDYDQIRELALKERPKLLICGYSAYPRIIEFDKFRAIADEIGAYLMADIAHIAGLVATGHHPSPISYCDVVTTTTHKTLRGPRGGLILTRDADLGKQFDKAVFPGTQGGPLEHVIAAKGVAFGEALKPQFKAYSGQVIANSRALAAQLMERGFKLVSGGTDNHLMLVDLRSIGMTGKEADRLVSEINITANKNTVPFDPESPFVTSGLRLGSPALTTRGMGESEFKEIGNIIADYLLSRGDEAVKHDCLGRVKSLCDRFPLYPGMKMAALV

glyA

Serine hydroxymethyltransferase

425 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

45.871 kDa

MHKTERGDAMTALQQQDPEIFSLIQQEEVRQHNKIRLIASENYVSSAVLEATGSILTNKYSEGYPGKRYYEGQQLIDQIESIAIDRAKAVFGAEHVNVQPYSGSPANMAVYLAFLKPGDTILGMALPHGGHLTHGSKVSISGKYFNAVSYALNEEGILDYEEIRNKALECKPKILIAGHSAYPRILDFAKFREIADEVGALLMVDMAHFAGLVAGGVHPSPFPYADVVTTTTHKSLRGPRGAMIMCKAEYAKAIDKAVFPGMQGGPHDSTTAAIAVALKEASTDSFKKYTAQVVENAASLADVLIEKGFNLVTGGTENHLMLIDLSNKNITGKQAAKALDAAGIVLNCNSVPFDKRKPFDPSGIRLGTCAITSRGFAKAEMVILGNMMDRVVNNFEDSAVLAEIAQEVQALCDKFPAPGLEHIAK

glyA

Serine hydroxymethyltransferase

425 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

45.575 kDa

MVGYIGDIHISESDAEVAECLSAEYKRQNTSLQMIASENFVSRAVLQAQGSVLTNKYAEGYPGSRYYCGCSEVDVAETLAVERLCKLFGCKYANVQPHSGSQANQQVYMALLKPGDTVLGMSLDSGGHLTHGAGPNVSGKWFNAVPYNVRRDTNLLDMGEIEEIALRVKPNLIIAGASSYPRRIDFKAFRAIADKVGAYFLADIAHYSGLIAGGQYPTPFGYAHVVTSTTHKTLRGPRGGVIMTDDEEIHKKLRSAVFPGMQGGALMHVIAAKAVAFREAMSPDFKVYVSQILDNSRALAAVLATGGLDVVTGGTDSHMVVVDLRSKGLTGRDVSSSLERAGIVCNKNAVPFDTEKPWVTSGIRLGAAAETSRGLVVKDFEKIGQLVLKIVDSMRAGADMSVVESGVREEVATLVRVVPYDTLAC

glyA

Serine hydroxymethyltransferase

425 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

46.231 kDa

MPDNNLEILFQHDPAMAEIIQGELQRQRDHLELIASENFTSEAVLAAQGSVLTNKYAEGLPKKRYYGGCEYIDRAEQLAIDRAKELFGAAHANVQPHSGAQANFAVFLALLSPGDTIMGMDLSHGGHLTHGSPVNVSGKWFKVCHYGVNPDTERLDYDQIRELALKERPKLLICGYSAYPRIIEFDKFRAIADEIGAYLMADIAHIAGLVATGHHPSPISYCDVVTTTTHKTLRGPRGGLILTRDADLGKQFDKAVFPGTQGGPLEHVIAAKGVAFGEALKPQFKAYSGQVIANSRALAAQLMERGFKLVSGGTDNHLMLVDLRSIGMTGKEADRLVSEINITANKNTVPFDPESPFVTSGLRLGSPALTTRGMGESEFKEIGNIIADYLLSRGDEAVKHDCLGRVKSLCDRFPLYPGMKMAALV

glyA

Serine hydroxymethyltransferase

425 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

45.871 kDa

MHKTERGDAMTALQQQDPEIFSLIQQEEVRQHNKIRLIASENYVSSAVLEATGSILTNKYSEGYPGKRYYEGQQLIDQIESIAIDRAKAVFGAEHVNVQPYSGSPANMAVYLAFLKPGDTILGMALPHGGHLTHGSKVSISGKYFNAVSYALNEEGILDYEEIRNKALECKPKILIAGHSAYPRILDFAKFREIADEVGALLMVDMAHFAGLVAGGVHPSPFPYADVVTTTTHKSLRGPRGAMIMCKAEYAKAIDKAVFPGMQGGPHDSTTAAIAVALKEASTDSFKKYTAQVVENAASLADVLIEKGFNLVTGGTENHLMLIDLSNKNITGKQAAKALDAAGIVLNCNSVPFDKRKPFDPSGIRLGTCAITSRGFAKAEMVILGNMMDRVVNNFEDSAVLAEIAQEVQALCDKFPAPGLEHIAK

glyA

Serine hydroxymethyltransferase

425 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

46.448 kDa

MTHIDWLVQTDPLVAEMVQREVQRQQQHLELIASENFTSPAVMAAQGTVLTNKYAEGLPGKRYYGGCEFVDEVEQLAIDRAKELFGAAHANVQPHSGAQANFAVFLALLNPGDTIMGMDLSHGGHLTHGSPVNVSGKWFNVVHYGVHPETERLDMDQVRDLARQHRPKLIICGYSAYPRVIPFAEFRQIADEVGAYLMADIAHIAGLVASGYHPNPVPLCDVVTTTTHKTLRGPRGGLILTRDEDLGKKLDKAVFPGTQGGPLEHVIAAKAVAFGEALKPEFKAYCGQVIRNAQALAAGLQARQLRLVSGGTDNHLMLIDLRSVNLTGKEADRLMGEIHITTNKNTIPFDPASPFVTSGLRLGTPALTTRGFTEVEFAEVAEIISDRLHAPEDEAIKNRCRERVAALCAQFPLYPHLQFPQPVLA

glyA

Serine hydroxymethyltransferase

425 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

46.011 kDa

MINANFLADTDPLVAEIIQKEYGRQQDHLELIASENFTSPAVMAAQGSVLTNKYAEGLPSKRYYGGCEFIDEVEQIAIDRAKQLFGAAHANVQPHAGAQANLAVFLTLLKPGDTIMGMDLSHGGHLTHGSPVNISGKWFKAHHYGVNKETEAIDYDQVLELAKKHKPKLLICGYSAYSQIINFEKFRAIADEVGAYLLADIAHIAGLVATGHHPNPVPHCDVVTTTTHKTLRGPRGGLILTRDSELGKKLDKSVFPGTQGGPLEHVIAAKAVAFGEALKPEFKTYSGQVIENAAALATQLQERKLKIVSGGTENHVMLVDLRSVSMTGKKADKLMSGVNITANKNTVPFDPESPFVTSGLRLGSPAMTSRGMKATEFIEIGDIIAERLQNPEDEGIAQKCRERVASLCKAFPLYPHMMAKVPSLV

glyA

Serine hydroxymethyltransferase

425 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

46.217 kDa

MMSVLKKICGSKNSLKSFDNEVYQSIEKELQRQKSQLQLIASENFASKAVMEAQGSFLTNKYAEGYPGKRYYCGCEHVDKIESLAIERLCKLFGVKFANVQPHSGSQANQAVFASLLTPGDTILGLSLSCGGHLTHGAAPSLSGKWFKSIQYTVNKDTYLLNMDEIEKLALEHKPKLIIAGASAYPRKMDFKRFREIADKVGAYLLADIAHYAGLIAAGEYPSPAEYAHVMTSTTHKTLRGPRGGIVMTNDEALHKKIQSAVFPGLQGGPLMHVIAAKAVAFKEALAPEFKTYSKKVVENAKVLAQELQKHGLDIITGGTDSHIVLVDLRSQKLTGKDVVDSLERAGITCNKNSVPFDTAKPTITSGLRFGTAAETTRGLEAENFKEIAGLINEVIQGLISGNSSSVEKAVKAKVERICSNFPIY

glyA

Serine hydroxymethyltransferase

425 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

46.513 kDa

MTIASERICNSENNLKSCDNEVYLSIEKELQRQRSQLQLIASENFASKAVMEAQGSFLTNKYAEGYPGKRYYCGCEYVDEVENLAIERLCKLFNVKFANVQPHSGSQANQAVFASLLTPGDTILGLSLNCGGHLTHGAAPNLSGKWFKSIQYTVNRDTYLLDMDEVERLALEHKPKLIIAGASAYPRKIDFERFREIANKVGAYLLADIAHYSGLIAAGCYPSPAEYAHIITSTTHKTLRGPRGGVVMTNDEALHKKIQSAVFPGLQGGPLMHVIAAKAVAFKEALAPEFKTYSKKVVENAKVLAQALQGHGLNIITGGTDSHIVLVDLRSQKLKGKDVVNSLERAGITCNKNSVPFDTEKPTITSGLRFGTAAETTRGLEKKDFKEIADLINEIIQGLIDGNSPDVEKAVKNKVESICSNFPIY

glyA

Serine hydroxymethyltransferase

425 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

46.706 kDa

MTNVSERIYDSKNSLKFLDDEIYQSIERELQRQRSQLQLIASENFASKAVMEAQGSFLTNKYAEGYIGKRYYCGCEYVDEVENLAIERLCKLFNVRFANVQPHSGSQANQAVFASLLTPGDTILGLSISCGGHLTHGAAPNLSGKWFKSIQYAIDRGTCLLDMDEVERLALEHKPKLIIAGASAYPRRMDFKRFREIADKVSAYLLADIAHYAGLIAAGEYPSPAKYAHIITSTTHKTLRGPRGGVVITNDEALHKKVQSAVFPGLQGGPLMHVIAAKAVAFKEALAPEFKAYIKRVVENAKVLAQALQKHGLSVITGGTDSHIVLVDLRPQKLTGKGAVDSLERAGITCNKNSVPFDMEKPTITSGLRFGTAAETTRGLKAENFKEIADLINEVIQGLINGNNSDVERIVKNKVKKICDDFPIY

glyA

Serine hydroxymethyltransferase

425 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

46.318 kDa

MMSVLKKICGSKNSLKSFDNEVYQSIEKELQRQKSQLQLIASENFASKAVMEAQGSFLTNKYAEGYPGKRYYCGCEHVDKIESLAIERLCKLFGVKFANVQPHSGSQANQAVFASLLTPGDTILGLSLSCGGHLTHGAAPSLSGKWFKSIQYTVNKDTYLLDMDEIEKLALEHKPKLIIAGASAYPRKMDFKRFREIADKVGAYLLADIAHYAGLIAAGEYPSPAEYAHVMTSTTHKTLRGPRGGIVMTNDEILHKKIQSAVFPGLQGGPLMHVIAAKAVAFKEALAPEFKTYSKKVVENAKVLAQELQKHGLDIITGGTDSHIVLVDLRSQKLTGKDVVDSLERAGITCNKNSVPFDTAKPTITSGLRFGTAAETTRGLEAENFKEIADLINEVIQGLISGNSSSVEKAVKAKVERICSNFPIY

glyA

Serine hydroxymethyltransferase

425 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

45.154 kDa

MPVDQSFNAPLSEVDPEIAAVLEQELGRQRGTLEMIASENFVPRAVLQSQGSVLTNKYAEGYPGRRYYGGCEFVDVAEQLAIDRAKSLFGAEFANVQPHSGATANAAVLAAIAQPGDMILGLELAHGGHLTHGMKLNFSGKLYDAAAYGVDPDTFLIDMDVVREKALAHRPQVIIAGWSAYPRHLDFAAFRSIADEVGAKLWVDMAHFAGLVAAGVHPSPVPYADVVSSTVHKTLAGPRSGVILSRDTALAKKLNSAVFPGQQGGPLMHVIAAKATAFKIAATEEFADRQRRTIQGAQILAERLVAADSTEAGVSVLTGGTDVHLVLADLRNSPIDGKQAEDALHEVGITVNRNSVPFDPRPPMVTSGVRIGTSALATRGFGETEFTEVADIIAETLKPDSDLAALRARVLTLTDGFPLYEGLTQ

glyA

Serine hydroxymethyltransferase

424 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

45.731 kDa

MNYEQVREADPAIAAALADERDRQEDTLAMIASENHVSEAVLQAQSSELTNKYAEGYPGERYYAGCGPADDVEELAIERAEELWGAEHINVQPHSGTQANMAVYLAMLEPGDRILSLELEHGGHLSHGHPANFTGQTYEVEQYEVDPETGYIDYDELHEQAEAFEPDIIVSGYSAYPREVEFERIQEAADAVDAYHLADIAHITGLVAAGVHQSPVGVADFVTGSTHKTIRAGRGGIVMCDEEYADDIDAAVFPGAQGGPLMHNVAGKAVGFKEALQPEFEQYAQQVIDNAEALGERLQEHGFSLVSGGTDNHLVLVDLRESHPDTSGTVAEEALEAAGIVLNKNTVPGETRSAFNPSGIRAGTPALTTRGFDEQACERVADIIANVIDNPDDEGTIDEAAAEVDALCEEYPLYQGESGITDFE

glyA

Serine hydroxymethyltransferase

424 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

45.731 kDa

MNYEQVREADPAIAAALADERDRQEDTLAMIASENHVSEAVLQAQSSELTNKYAEGYPGERYYAGCGPADDVEELAIERAEELWGAEHINVQPHSGTQANMAVYLAMLEPGDRILSLELEHGGHLSHGHPANFTGQTYEVEQYEVDPETGYIDYDELHEQAEAFEPDIIVSGYSAYPREVEFERIQEAADAVDAYHLADIAHITGLVAAGVHQSPVGVADFVTGSTHKTIRAGRGGIVMCDEEYADDIDAAVFPGAQGGPLMHNVAGKAVGFKEALQPEFEQYAQQVIDNAEALGERLQEHGFSLVSGGTDNHLVLVDLRESHPDTSGTVAEEALEAAGIVLNKNTVPGETRSAFNPSGIRAGTPALTTRGFDEQACERVADIIANVIDNPDDEGTIDEAAAEVDALCEEYPLYQGESGITDFE

glyA

Serine hydroxymethyltransferase

424 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

45.637 kDa

MTESVTNQPLSDVDPDVAQAIQDELGRQRSTLEMIASENFAPRAVLEAQGSVLTNKYAEGYPGRRYYGGCEYVDVVENLARDRACELFGADHANVQPHSGAQANTAVMAALMQPGDTLMGLSLAHGGHLTHGMKINVSGKLYNIAAYEVEPETYRIDMDRVREQALEARPNVIVAGWSAYSRQLDFEAFRSIADEVGAKLWVDMAHFAGLVAAGLHPNPVPHAHVTTSTVHKTLAGPRSGVILCEADLKKKIDSAVFPGQQGGPLMHAIAGKAVAFKIAASEGFAERQRRTIEGAQILAERLTAPDLAEHGVSVLTGGTDVHLVLVDLRDSELDGKQAEDLLHRAGITVNRNAVPWDPRPPMVTSGLRIGTPALATRGFGAEQFTEVADVIAQALMPGADVDALRSRVDALTEQFPLYPGLEEW

glyA

Serine hydroxymethyltransferase

424 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

46.404 kDa

MQRDTQVFDLIAKEKERQLNGLELIASENFVSEAVLEAAGSVLTNKYAEGYPGKRYYGGCEVVDQVEQLAIDRLKELFNAEYANVQPHSGSQANTAVFHTVMKPGDKFLGFDLSHGGHLTHGSPVNFSGKLYNPVFYGVDKETGLIDYDAVAEIAEKEKPKMIIAGASAYSREIDYKRFREIADSVGAILVADMAHPAGLIAKGLISDPLPHCHIVTSTTHKTLRGPRGGIILMGKDFENPFGEKLKNGNLKKMSTMLNSGIFPGNQGGPLEHIIAAKAIAFGEALTDEFLHYTVQVKKNAEKLAQAFVEKDYKVISGGTDNHMMLIDLRNKNVSGKEAEEALSKADITVNKNMVPFDDKSPFVTSGIRIGTPAVTTRGLQENDMNKIVDLIDRVITNIENDTELEAVKKEVNSMMSGRPLFVA

glyA

Serine hydroxymethyltransferase

424 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

45.739 kDa

MTDRCLASINAALTDSDPAIAGLIDQERQRQETHLELIASENFTSQAVMQAQGSVLTNKYAEGLPHKRYYGGCEHVDAIEELAIERARRLFGAAWANVQPHSGAQANFAVFLALLQPGDTIMGMDLSHGGHLTHGSPVNVSGKWFKVVHYGVEPDSQQLDMEAVRQLALKERPQLIICGYSAYPRTIDFAAFRSIADEVGAYLLADMAHIAGLVAAGVHPSPIAHCDVVTTTTHKTLRGPRGGLILCRDADFGRKFDKAVFPGSQGGPLEHVIAAKAVALGEALQPEFHAYSCQVVANAQVLAGRIQERGIAVVSGGTDNHLVLLDLRSIGMTGKVADLLVSDVNITANKNTVPFDPESPFVTSGLRLGTAALTTRGFDEEAFREVADVIADRLLKPQDESIKAQCLERVRQLCGRFPLYRGSL

glyA

Serine hydroxymethyltransferase

424 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

46.865 kDa

MWENVKKTDPEIYDVILKEWERQEYGLELIASENFASLAVIEAMGSVLTNKYAEGYPGRRYYGGCEWVDVAEKLARDRAKELFNVKYANVQPHSGSQANMGAYFAVSEPGDTIMGMSLSHGGHLTHGASVNFSGRIYNVVPYGVNPETEVIDYDEVRDLALKHKPKIIVAGGSAYSRIIDFKKFREIADEVGAYLIVDMAHFAGLVAAGIYPNPAEYAHIVTSTTHKTLRGPRGGMILTNDNELYKAINKSIFPGIQGGPLMHVIAAKAVCFKEALTDEFKEYQKQVVKNAKTLAAELEKRGLRIVSGGTDTHLMLVDLNPLNVTGKAAEIALGKCHITVNKNTIPNETRSPFIASGIRLGTPALTTRGMKESEMEEIAELIVDVLKHVKDEEGNVDEEIVEKTQKKVKDLCTRFPLYEGKIKL

glyA

Serine hydroxymethyltransferase

424 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

46.884 kDa

MWENVKKVDPEIYEVILKEWDRQEYGLELIASENFASLAVIEAMGSVLTNKYAEGYPGRRYYGGCEWVDVAEKLARDRAKELFNVKYANVQPHSGSQANMGAYFAVSEPGDTIMGMSLSHGGHLTHGAPVNFSGRIYNVVSYGVDSETEVINYDEVRELALKHKPKIIIAGGSAYSKIIDFKRFREIADEVGAYLIVDMAHFAGLVAAGIYPNPAEYAHIVTSTTHKTLRGPRGGMILTNDKELYKAINKSIFPGIQGGPLMHVIAAKAVCFKEALTDEFKAYQNQVVKNAKKLAEELEKRGLRIVSGGTDTHLMLVDLNPLNVTGKAAEIALGKCHVTVNKNTIPNETRSPFVASGIRLGTPALTTRGMKESEMEEIAELIVKVLENVKDEEGNVDDSIVEDVQKKVRDLCERFPLYEGKIRL

glyA

Serine hydroxymethyltransferase

424 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

46.627 kDa

MLRDQQIFDLIIEEQDRQIHGLELIASENFVSDQVMEAAGSVLTNKYAEGYPGKRYYGGCEVVDVIEQIAIDRAKDLFGAEYANVQPHSGSQANTAVFAACLKPGDTILGFDLSHGGHLTHGSPVNFSGKLYNPTFYGVEPETGMLNYDKIQEIATKEQPKLIIAGASAYSRDMDFERFRKIADSVGAILMADISHPAGLIAKGLMNDPIPHCHIITTTTHKTLRGPRGGLIMMGKDFENPWGLKTPKGEIRMMSHVLDMSVFPGNQGGPLEHIIAAKAVAFGEALTDEFFRYAMQVQKNAKAMAAAFVKRDYHIISGGTDNHMMLIDLRNKNISGKEAENALVKAEITVNKNMVPFDDKSPFVTSGIRVGTPAITTRGLLEEDMETIVAFIDKVIMNHTNEEILEEVADAVNEMMGERAIFVF

glyA

Serine hydroxymethyltransferase

424 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

46.402 kDa

MWDHLKVTDSEVHDLLIGELKRQEYGLELIASENFASVAVMEAMGSILTNKYAEGYPAKRYYGGCEWVDKIEDLARERAKQLFKVKYANVQPHSGSQANMAAYLSIAEPGDVLMGMSLSHGGHLTHGASVNFSGKLFKVIQYGVNPETEMINYDEVRSMALQYKPKIIVAGGSAYSRIIDFKKFREIADEAGAYLVVDMAHFAGLVAAGLYPNPAEYAHIVTSTTHKTLRGPRGGLILTNDAEIYKAVNKTVFPGTQGGPLMHVIAAKAVCFKEAMSSGFVEYQKQVIANAKTLANELSSMGLRIVSGGTDTHLMLVDLTPLNVTGKAAEKALEKCGVTVNKNTIPNETRSPFVASGIRIGTPAVTTRGMREKEMKKIAELIFEVLKNVLDEEGNIPPHIQANVQMAVKKLCEEFPLYVDKIII

glyA

Serine hydroxymethyltransferase

423 amino acids

Catalyzes the reversible interconversion of serine and glycine with a modified folate serving as the one-carbon carrier. Also exhibits a pteridine-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

46.145 kDa

MLNPDVKTIVDAVEGSQDLFRHSLPMIASENVTSPMVRKVLSSDLGHRYAEGQVGHRFYQGCGFVDVIEGKAIELAKEIFRAPHVNVQPVSGVNCNIAAFFALADPGDKLMALAVPSGGHISHAKFSAAGIRGLKIYTHPYDNQIMNIDVDRMIKQIREIRPRVVMFGASLFLFPHPVKEAREVCDEVGASIVYDGAHVLGLIAGGQFQDPLREGADVVTGSTHKTFPGPQGGIILCKEKFAKDIDEAVFPGTVSNAHLHHKAGLAITLAEMKAFGKQYAAQIVKNSQALGAAMDDLGFNVLCKDLGYTKSHQIAVDVSKIGGGSVLASKLERANIITNKNLFPWDDVNTTDNPSGLRLGTQELTRLGMNEPEMKEVAKFIKRVAIDKEEPEKVKKDVVHFKSQYQAVKYCFDGDGAYEFSLR

glyA

Serine hydroxymethyltransferase

423 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

45.529 kDa

MSVTSEVQGLRALNEVDPEIAELIRLEERREADTLRLIASENYVSRAVLEATGSVLTNKYSEGYPHKRYYEGQQQVDVVEELARTRVAKLFGADHVNVQPYSGSPANLAVYLAFAQANDTIMGLGLPAGGHLTHGWSVSITGKYFKSVPYGVRESDHRIDLDQVRDLARAHRPKLIWCGTTAYPRTLDFAAFRAIADEVGAILAADIAHIAGLVAAGVHPSPVGIADVVTSTTHKTFRGPRGAMILCKKEHAGAIDKAVFPGLQGGPHNHTTAAIAVAAKEASEEGFRAYARQIVVNAQALGRALESRGFRLITGGTDNHLLLIDMTPKGIAGKPYAQALDRAGIVANYNSIPFDPRKPFDPSGLRIGTPAVTSRGMGVAEMERLAAWMDEVAQNVNDEARIARIAAEVAELCRGFPAPGIRL

glyA

Serine hydroxymethyltransferase

423 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

45.903 kDa

MFDKNMTIAGYDDALADAMNAEAQRQEDHIELIASENYTSPRVMEAQGSVLTNKYAEGYPNKRYYGGCEHVDVVEQLAIDRAKELFGADYANVQPHSGSQANAPVYMALLEPGDTVLGMSLAHGGHLTHGSHVSFSGKMYNAVQYGLNPETGVIDYDEVERLAKEHKPKMIIAGFSAYSQVVDWQKFREIADAVGAYLMVDMAHVAGLVAAGEYPNPVQIADVTTTTTHKTLRGPRSGLILAKSNPEIEKKLNSAIFPGAQGGPLMHVIAAKAVAFKEAMEPEFKTYAKQVKVNAKAMADVFMARGFDVVSKGTENHLFLVSFIEQGLTGKLVDAALGEAHITINKNSVPNDPMSPFVTSGIRVGTAASTTRGFTEEDSKNLASWMCDVIDSCQQASESWDEKVVADVREKVKALCAARPVYK

glyA

Serine hydroxymethyltransferase

423 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydromethanopterin (H4MPT) serving as the one-carbon carrier. Cannot use tetrahydrofolate (THF or H4PteGlu) instead of H4MPT as the pteridine substrate. Also probably exhibits a pteridine-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

47.223 kDa

MVSNQDYTEKIRQLMKDHNSWMESSINLIASENITSSRVKEALLSDLSHRYAEGLPGERLYEGCRYIDEIEELTIELSKRLFRAEHANVQPTSGVVANLACFFATAEVGDPIMAMEVPYGGHISHARVSAAGVRGFQIYTHPFDFENMNIDADAMKKKILEVKPRIILFGGSLFLFPHPVEEALEAAEEVGARIMYDGAHVLGLIAGGYFQDPLREGADMLVGSTHKTFPGPQGGIILCREELAADIDEAVFPGLVSNHHLHHVAGLGIATAEMLEFGAEYAAQTINNARKLAENLHELGFNVLCEHLDFTESHQVVMDVSDIGRAAEISKRLEANNIILNKNLLPWDDVNRSDDPSGIRIGTQEITRRGMKESEMSEVAEYIKRVVMDGKDVRDEVAEFMSSYTRVHYAFEDSEAYKYMEIQ

glyA

Serine hydroxymethyltransferase

423 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydromethanopterin (H4MPT) serving as the one-carbon carrier. Also exhibits a pteridine-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

47.077 kDa

MVSNQDYTERIRDLMKDHNSWMESSINLIASENITSSRVKEALISDLSHRYAEGLPGERLYEGCRYIDEIEEITIELSKKLFRAEHANVQPTSGVVANLACFFATADVGDPMMAMEVPYGGHISHAKVSAAGVRGFKIYTHPFDFENMNIDADAMKKKILEVKPRIILFGGSLFLFPHPVEEAVEAAEEVGARIMYDGAHVLGLIAGGYFQDPLREGADMLVGSTHKTFPGPQGGIILCREELADDIDEAVFPGLVSNHHLHHVAGLGIATAEMLEFGSEYAAQTIRNAKKLAENLNELGFNVLCEHLDFTESHQVVMDVSDIGRAAEISKKLEANNIILNKNLLPWDDVNRSDDPSGIRIGTQEITRRGMKESEMSEVAEYIKKVVIDGRNVKEEVSEFMSSYTKVHYAFEESGAYKYMEIL

glyA

Serine hydroxymethyltransferase

423 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

45.133 kDa

MRSPQALLQGDPEIAGLINKELERQQSHLELIASENFASPAVMAAQGSVLTNKYAEGLPNRRYYGGCEHVDAIEELAIERAKQLFGAAWANVQPHSGAQANFAVFLALLKPGDTILGMDLSHGGHLTHGSPVNVSGKWFKAVHYGVDPETQQLNLESIRQLALEHKPKLIVCGYSAYPRSIDFAGFRAIADEVGAYLLADMAHIAGLVAAGVHPSPVPHCHVVTTTTHKTLRGPRGGLILCNDADFAKQFDKAVFPGTQGGPLEHVVAAKAVAFGEALQPSFKQYSQQVVANAQALAERLQERGIAVVSGGTDNHVVLLDLRGIGMTGKVADLLVSEVNITANKNTVPFDPESPFVTSGLRLGTAALTTRGFDEAAFSEVADVIADRLLNPEDAAIEQRCRDRVASLCQRHPLYGPASPVLAA

glyA

Serine hydroxymethyltransferase

423 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

46.26 kDa

MNILQNLKESDPVISNFIKSEKNRQETHLELIASENFASIAVMEAQGSVLTNKYAEGLPQKRYYGGCEFVDQIEELAIQRAKKLFNANWANVQPHSGAQANAAVFLSLLKPGDTIMGMDLSHGGHLTHGSPVNMSGKWFNAVHYGVNKETSELNFDEIREIALETKPKLIICGYSAYPRTIDFESFRNIADEVGAFLMADIAHIAGLVASKLHPNPIPYCDVVTTTTHKTLRGPRGGLILCKDAEFGKKFDKSVFPGTQGGPLEHIIAAKAVAFGEALQPDFVNYSQQVIKNAKVLASTLINRGIDIVSGGTDNHIVLLDLRSINMTGKIADLLVSEVNITANKNTVPFDPESPFVTSGLRLGTAALTTRGFNENAFAEVGEIIADRLLNPDDSLIESQCKERVLTLCNRFPLYESKLEASIK

glyA

Serine hydroxymethyltransferase

423 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

46.161 kDa

MNILQNLKDSDPVISNFINSEKNRQETHLELIASENFASIAVMQAQGSVLTNKYAEGLPQKRYYGGCEFVDEIEELAINRAKKLFNANWANVQPHSGAQANAAVFLSLLKPGDTIMGMDLSHGGHLTHGSPVNMSGKWFNAVHYGVNKETSELNFDEIREIALETKPKLIICGYSAYPRTIDFESFRNIADEVGAFLMADIAHIAGLVASKLHPNPIPYCDVVTTTTHKTLRGPRGGLILCKDAEFGKKFDKSVFPGTQGGPLEHIIAAKAVAFGEALQPDFVNYSQQVIKNAKVLASTLINRGINIVSGGTDNHIVLLDLRSINMTGKIADLLVSEVNITANKNTVPFDPESPFVTSGLRLGTAALTTRGFNENAFEEVGEIIADRLLNPNDSLIESQCKERVLSLCNSFPLYEGKLEASIK

glyA

Serine hydroxymethyltransferase

423 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

46.196 kDa

MNILQNLKKSDPIISNLINSEKNRQETHLELIASENFASMAVMQAQGSVLTNKYAEGLPQKRYYGGCEFVDEIEELAIERAKQLFDADWANVQPHSGAQANAAVFLSLLNPGDTILGMDLSHGGHLTHGSPVNMSGKWFNAVHYGVDKETNKLNFNVIRDIALATKPKLIICGYSAYPRTIDFKSFRSIADEVGAFLMADIAHIAGLVASKLHPNPIPYCDVVTTTTHKTLRGPRGGLILCKDKEFGKKFDKSVFPGTQGGPLEHIIAAKAVAFGEALQPNFVNYSKQVIKNAKVLSSTLINRGIDIVSGGTDNHIVLLDLRSINMTGKVADLLVSEVNITANKNTVPFDPESPFVTSGLRLGTAALTTRGFNDEAFIEVGEIIADRLLNPDDLLIEKECKERVLSLCNSFPLYEAKLESSIK

glyA

Serine hydroxymethyltransferase

423 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

46.016 kDa

MNILQNLKKSDPVISNFINSEKNRQETHLELIASENFASIAVMQAQGSVLTNKYAEGLPQKRYYGGCEFVDEIEELAIQRAKKLFNANWANVQPHSGAQANAAVFLSLLQPGDTIMGMDLSHGGHLTHGSPVNMSGKWFNAVHYGVNKETSELNFDEIREIALETKPKLIICGYSAYPRTIDFESFRNIADEVGAFLMADIAHIAGLVASKLHPNPLPYCDVVTTTTHKTLRGPRGGLILCKDGEFGKKFDKSVFPGTQGGPLEHIIAAKAVAFGEALQPDFVNYSQQVIKNAKVLASTLISRGIDIVSGGTDNHIVLLDLRSINMTGKIADLLVSAVNITANKNTVPFDPESPFVTSGLRLGTAALTTRGFNETAFAEVGEIIADRLLNPNDSVIESQCKDKVLALCNRFPLYEGKLEASIK

glyA

Serine hydroxymethyltransferase

423 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

46.407 kDa

MNILQNLKESDPIISNLINSEKNRQETHLELIASENFASMAVMQAQGSVLTNKYAEGLPQKRYYGGCEFVDEIEELAIERAKQLFDADWANVQPHSGAQANAAVFLSLLKPGDTILGMDLSHGGHLTHGSPVNMSGKWFNAVHYGVDKETNKLNFNEIRDIALATKPKLIICGYSAYPRKIDFESFRRIADEVGAFLMADIAHIAGLVATKLHPNPIPYCDVVTTTTHKTLRGPRGGLILCKDKEFGKKFDKSVFPGTQGGPLEHIIAAKAVAFGEALKPNFVNYSKQVINNAKVLSSTLIKRGIDIVSGGTDNHIVLLDLRSINMTGKVADLLVSEVNITANKNTVPFDPESPFVTSGLRLGTAALTTRGFNDDAFVEVGEIIADRLLNPDDLLTEKKCKERVLTLCNRFPLYEVELEASIK

glyA

Serine hydroxymethyltransferase

423 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

45.104 kDa

MTAQSTSLTQSLAQLDPEVAAAVDAELARQRDTLEMIASENFAPRAVLEAQGTVLTNKYAEGYPGRRYYGGCEHVDVIEQLAIDRAKALFGAEHANVQPHSGAQANTAVYFALLQPGDTILGLDLAHGGHLTHGMRINYSGKILNAVAYHVRESDGLIDYDEVEALAKEHQPKLIIAGWSAYPRQLDFARFREIADQTGALLMVDMAHFAGLVAAGLHPNPVPYADVVTTTTHKTLGGPRGGLILAKEELGKKINSAVFPGMQGGPLQHVIAAKAVALKVAASEEFAERQRRTLSGAKILAERLTQPDAAEAGIRVLTGGTDVHLVLVDLVNSELNGKEAEDRLHEIGITVNRNAVPNDPRPPMVTSGLRIGTPALATRGFGDADFAEVADIIAEALKPGFDAATLRSRVQALAAKHPLYPGL

glyA

Serine hydroxymethyltransferase

423 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

46.314 kDa

MNILQNLKESDPVISNFINSEKNRQETHLELIASENFASIAVMQAQGSVLTNKYAEGLPQKRYYGGCEFVDEIEELAIQRAKKLFNANWANVQPHSGAQANAAVFLSLLKPGDTIMGMDLSHGGHLTHGSPVNMSGKWFNAVHYGVNKETSELNFDEIREIALEKKPKLIICGYSAYPRTIDFESFRNIADEVGAFLMADIAHIAGLVASKLHPNPIPHCDVVTTTTHKTLRGPRGGLILCKDAEFGKKFDKSVFPGTQGGPLEHIIAAKAVAFREALQPDFVNYSQQVIKNAKVLASTLINRGINIVSGGTDNHIVLLDLRSINMTGKIADLLVSEVNITANKNTVPFDPESPFVTSGLRLGTAALTTRGFNENAFAEVGEIIADRLLNPDNSLIESQCKERVLTLCNRFPLYEGKLEASIK

glyA

Serine hydroxymethyltransferase

422 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

45.035 kDa

MNTADLKSFDPEVQSAIDEELGRQRHQIELIASENIVSPAVMAAQGSVMTNKYAEGYPAKRYYGGCEFVDKVEVLAIERAKQLFGCAYANVQPHSGSQANMAAFMAIAPAGSTILGMSLAHGGHLTHGAKVNFSGQIYNAVQYGLNGESERIDFDQVQALAMEHKPAIIVAGASAYSRIIDFAKFREICDAVGAKLVVDMAHFAGLVATGEHPSPFPHADIVTTTTHKTLRGPRGGMILTNDEELAKKINSKIFPGIQGGPLMHVIAAKAVAFKEALSPEFKIYTQQVRKNAVALAEVLVEGGLRIVSGGTDNHLMLVDLTSRDITGKDTEHALERAGLTCNKNAIPNDPRSPFITSGVRLGTPAATTRGFDEEAFRAVGRLIVRVVDAVAASGGAGDPAIEAEVHKEVDALCQKFPIYADI

glyA

Serine hydroxymethyltransferase

422 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

46.403 kDa

MWELLAKGDPEVYEIVMKELGRQEEGLELIASENFVSPAVMEAMGSTLTNKYAEGYPRRRYYGGCKFVDEAEQLARERVKKLFNCKYANVQPHSGSQANMAAYLAVANPGDTIMGMSLSHGGHLTHGSPVNFSGKLFNIVSYGVDLETEVLDYDEIERLALEHKPKIIIAGGSAYSRIIDFKRFREIADKVGAYLIVDMAHFAGLVAAGLYPNPVDHAHIVTSTTHKTLRGPRGGLILTNDEELYKAINKAVFPGIQGGPLMHVIAAKAVAFGEALKDEFKEYQMRIITNAKALAKELENLGLRIVSGGTDTHLFLVDLNPKNVTGKAAEKALESADITVNKNTIPKETRSPFVTSGIRIGTPAVTTRGMGESEMKVIAELIVKVIDNIQDEKGTIPEEIREEVKKAVHELTEKFPLYKDLT

glyA

Serine hydroxymethyltransferase

422 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

46.493 kDa

MLRDTQIFTLIEKEYQRQNEGLELIASENFVSQQIMEAAGSILTNKYAEGLPGRRYYGGCEIVDEIETLAIERAKSLFHASWANVQPHSGSQANAAVMFAVLEPGDKILGFNLAHGGHLTHGSPVNFSGQLYESHFYGVQPETGLIDWEEVGTIAEQVNPKLIICGASAYSRDWDYKRLRAIADQVGALLLADISHPAGLISRGLLNDPVPYCHFITTTTHKTLRGPRGGMILMGADFENPFGKKTTKGKLKSMSTLLDASVFPGIQGGPLEHIIAAKAIAFQEAMSDDYFNYILQVQKNTRQLAQSFVKRGYNIVSGGTDNHLILIDLRNKGITGKLAEEALIKASITLNKNMVPFDDQSPLITSGIRIGTPAVTTRGMQETDMEQIAAWIDDVLKNHENESKIDSIRKEIGNYMLQFPLP

glyA

Serine hydroxymethyltransferase

422 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydromethanopterin (H4MPT) serving as the one-carbon carrier. Also exhibits a pteridine-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

46.862 kDa

MTDYQNEVLEFERIMKEHTNYMRNSINLIASENITSSDVTEAVASDLAHRYAEGQSHERLYEGCQYIDEIEDRVIDLSKKLFNVDYANVQPISGVTANLAAFFGYSDYGDKLMALDVPYGGHISHAKVSAAGIAGLKTISHPFDKDIMNIDIDAMNKKILEEKPKIVLFGGSLFLFPHPVKEAREAADEVGAKIMYDAAHVLGLIAGGQFQQPIAEGADLMMGSTHKSFPGPQGGIILSHKENKEVIDNAVFPGVVSNHHLHHLAGLGIASAEMLEFGQDYAKQIVKNSKALAQSLYERGFDVLCEELGFTESHQLAINVSNIRSASDIAHDLANNDVILNKNLLPGDNVDDSDNPSGLRIGTQEITRRGLKEKEMDEVAEFIKRVAVDKENIKDEVREFMDQYTTVHYSFSQNEGYRFHKL

glyA

Serine hydroxymethyltransferase

422 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydromethanopterin (H4MPT) serving as the one-carbon carrier. Also exhibits a pteridine-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

46.447 kDa

MSNLEQAERIKNLTKDHHNWMKNSLNLIASENITSRAVREAVASDLSHRYAEGLPGERLYEGCDYIDAIEEETIALSKKLYDAEHVNVQPTSGVVANLASFFALTKPGDLLMSINVPEGGHISHASVSAAGIRGLKISSVPMDDSIMNVDIDKTLSKIREKEPKAIVLGGSLFLFPQPVSEVADVAKEVGAKIIYDAAHVLGLIAGKRFQDPVKEGADIVTGSTHKTFPGPQGGIILCKEEIGRKVDNCVFPGVVSNHHLHHMAALGVATAEMLEFGKDYANQTISNAKALAQALYERGFNVLCEDQGFTESHQVAMDVAKLGDVSKMAKTLQYNNIILNKNLLPWDDVNDSDNPSGIRMGTQELTHRGFKEDEMDQVAEFIKQVVMDKKDVKEDVTEFMQDYTTVHYAFDEGCEGYDYIEF

glyA

Serine hydroxymethyltransferase

422 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

46.744 kDa

MLNHLKNVDPEVYSAISKEFKRQEEHLEMIASENYTSQAVMEAQGSVLTNKYAEGLPHKRYYGGCEYVDIVEDLAIERLKKLFGAEYANVQPHSGSQANQAVFFSQLQPGDTILGMRLDHGGHLTHGAKVNVSGIVFNSVQYGLNPQTELIDYDEVYRLAKEYKPKMIVAGASAYSRVIDFAKFREIADEVGALLMVDMAHYAGLIAGGVYPNPVPYAQFVTSTTHKTLRGPRGGVILCKSEYAKDIDKWVFPRLQGGPLMHVIAAKAVAFGEALTEDFKKYAEQVVKNARALAEELMAEGLRIVSGGTDSHMMLVDLRPLNVKGNQAEEALGKANITVNKNAIPFDPEKPTVTSGIRLGTAALTTRGMKENDMRRIAKNIVKVLKNLDNEKVIQEARDDVLSLCSSYPLYPDWFKDYGYGE

glyA

Serine hydroxymethyltransferase

422 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

45.594 kDa

MLEKKTIAELDPVLWDAMQNEVRRQEEHIELIASENYVTPAVMQAQGSQLTNKYAEGYPGKRYYGGCEYVDIVEQLAIDRAKELFGAEYANVQPHSGSQANAAVYGALLSAGDTILGMDLAHGGHLTHGAKVSFSGKIYNSVLYGITADGVIDYADVRTKALESKPKMIVAGFSAYSQVIDWAKMREIADEVDAYLFVDMAHVAGLIAAGLYPNPLPHAHVVTTTTHKTLAGPRGGLILSACGDEDIYKKLNSSVFPANQGGPLMHVIAAKAVCFKEALEPSFKVYQAQVLKNAKAMVEVFKQRGFDVVSNGTENHLFLVSFIKQGLTGKQADAALGAANITVNKNSVPNDPQKPFVTSGIRVGSPSITRRGFSETDAATLAGWMCDVLESIGKDNHEQVIAETKTKVLDICKRLPVYGIGR

glyA

Serine hydroxymethyltransferase

422 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

45.282 kDa

MFDKTQTIADFDPDVWQAIVDEGVRQEEHIELIASENYTSPLVMVAQGSKLTNKYAEGYPSKRYYGGCEYVDKVEELAIERAKALFGADYANVQPHSGSQANSAVYAALCAPGDTVLGMSLDHGGHLTHGAKVNFSGKMYNAVQYGLNPETGLVDYEEIAALAREHKPKMIVAGFSAYSQVLDWQKFRDIADEVGAYLMVDMAHVAGLVAAGVYPSPVQIADVTTTTTHKTLRGPRGGIILAKANPEIEKKLNSAVFPGGQGGPLMHVIAGKAISFKEAMSDEYKAYQQRVVDNAKTMAATFIKRGFKIVSGGTENHLMLVDLIGKDYSGKDADAALGAANITVNKNAVPNDPRSPFVTSGLRVGTPAITTRGFGETEVVDLTNWMCDVLESLEAGNSEAVIADVKAKVLDVCGKFPVYGSN

glyA

Serine hydroxymethyltransferase

421 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

46.869 kDa

MYKNLKLNDKYVQKAINSEFKRQRNFIELIASENYVSDDVLKAQGSVLTNKYGEGYPYRRYYGSCENVDMVEQVAIDRLKEIFKVNYANVQPYSGSVANAAAIASVVPNGGKIMGLSLKSGGHLTHGYKISFSGIFYNSITYEVGKNGKLDYEEIKKIALAEKPDLIICGYSAYPRLIDFKKFREIADLCGAKLMADVAHIAGLIAGGVHPSPVGYAHVITSTTHKTFRGARGGVIMTNDEEIAKKVDRWVFPGYQGGPLFHAIAGKAIAFYEALQPSFKTYAENIVKNAKVFSEAFIKKGVEVVSGGTDNHLLLINVKSSYNITGKEAENFLEKINITINKNSIPFDELPPLVTSGIRLGTAAMTSRNFTKWEELAEIIDYSLRNLEFLNSKSKAARDKVKELKNRVLSFNKEFPILKKY

glyA

Serine hydroxymethyltransferase

421 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

46.869 kDa

MYKNLKLNDKYVQKAINSEFKRQRNFIELIASENYVSDDVLKAQGSVLTNKYGEGYPYRRYYGSCENVDMVEQVAIDRLKEIFKVNYANVQPYSGSVANAAAIASVVPNGGKIMGLSLKSGGHLTHGYKISFSGIFYNSITYEVGKNGKLDYEEIKKIALAEKPDLIICGYSAYPRLIDFKKFREIADLCGAKLMADVAHIAGLIAGGVHPSPVGYAHVITSTTHKTFRGARGGVIMTNDEEIAKKVDRWVFPGYQGGPLFHAIAGKAIAFYEALQPSFKTYAENIVKNAKVFSEAFIKKGVEVVSGGTDNHLLLINVKSSYNITGKEAENFLEKINITINKNSIPFDELPPLVTSGIRLGTAAMTSRNFTKWEELAEIIDYSLRNLEFLNSKSKAARDKVKELKNRVLSFNKEFPILKKY

glyA

Serine hydroxymethyltransferase

421 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

46.376 kDa

MTHLNLRLKDVDPEIFEAMEKELSRQREKIELIASENFVSRAVMEAMGSHLTNKYAEGLPGKRYYGGCEYVDVVENLARERAKKLFGAEHVNVQPHSGAQANMAAYMAFLEPGDTVLGMNLAHGGHLTHGSPVNFSGKLYNFVSYGVEPDTEKINYEKVFELAYKHKPKMIVAGASAYPRVIDFKHLKEIADEVGAYLMVDMAHIAGLVAAGLHPSPIPYADVVTTTTHKTLRGPRGGVIFCKAEHAAKIDKTVFPGVQGGPLMHVIAAKAVAFKEALSPEFREYQQQVVNNAKALAEELKKQGLRLVSGGTDNHLMLVDVRPVGLTGKRAEQLLDEIGVTVNKNAIPYDPESPNVTSGIRIGTPAVTTRGMKEGEMAEIAEIIALVLKNPENEDKHREAARKVRDLLNRFPLYDKLPYND

glyA

Serine hydroxymethyltransferase

421 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

45.531 kDa

MFDKTQTIAAFDPEIWASIQNEGRRQEEHIELIASENYTSPLVMAAQGTKLTNKYAEGYPGKRYYGGCEYVDQSEALAIERAKQLFGADYANVQPHSGSQANTAVYAALCAPGDTVLGMSLAHGGHLTHGAKVNFSGKIYNAVQYGLNPETGLVDYDEVERLALEHKPKMIVAGFSAYSQVLDWQRFRDIADKVGAYLMVDMAHVAGLVAAGLYPNPVQIADVTTSTTHKTLRGPRGGIILAKANEEIEKKLNSAVFPGGQGGPLMHVIAAKAISFKEAMTPEYKDYQQQVVKNAKAMAATFIERGIKIVSGGTENHLMLVDLIGKPYSGKDADEALGKAHITVNKNAVPNDPRSPFVTSGIRVGTPAITTRGFKEAECIQLTNWICDIFAALEAGNADAVIEQVKTRVASLCKEFPVYAD

glyA

Serine hydroxymethyltransferase

421 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

46.186 kDa

MNIFNNHLHETDKEIDEIIKHEKLRQNSVIELIASENFVSPAVLEAQGSILTNKYAEGYSGKRFYNGCEEVDKAENLAIERVKKLFNCKYANVQSHSGSQANQAVYLALLQPGDTILGMSLDSGGHLTHGAAPNMSGKWFNAVSYSVNKETYLIDYDEIERLADLHKPKLLIAGFSAYPRNIDFARFREIADKVGAYFMADIAHIAGLVATGEHQSPIPYTHAVTSTTHKTLRGPRGGLILSNDEEIGKKINSALFPGLQGGPLMHIIAAKAVAFLENLQPEYKSYIKQVISNAKALASSLQERGYDILTGGTDNHIVLVDLCKDGITGKLAANSLDRAGITCNKNAIPFDETSPFITSGIRLGTPACTTRGFKEKDFVLVGHMVADILDGLKNNEDNGKAEQKVLTEVTKLIKLFPFYTR

glyA

Serine hydroxymethyltransferase

421 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

46.094 kDa

MYKKISMNDKEIEHAINNEVDRQNEHIELIASENYVSEDVLTAVGSVLTNKYGEGYPGKRYYGGCENVDVVETLAIERLKKLFGVKFANVQPYSGSVANAAALATLASQGDKIMGLDLASGGHLTHGYKISFSGIFYNSITYSVNEDGILDYEAIKELAIKEKPKVIICGYSAYSRIVDFKKFREIADACGAKLMADIAHIAGLIAGGVHPSPVPYADIITSTTHKTLRGARGAIIMTNDVEIAKKMNRWVFPGYQGGPLFHAIAGKAVAFGEALKPEYAAYAKSVVYNAREFSNYFIKQGVSIVSGGTDNHLFTINVNKSYGISGLQAEKILGKFNITVNKNTVPFDELSPAVTSGIRIGTAAMSSRKFAKWKELGAIMHEILQNCVEFSENESKHLDRIAELKKQVEALTTEFPIITKY

glyA

Serine hydroxymethyltransferase

421 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

45.992 kDa

MFTRNMTIADYDPVLWQAIQDENRRQEEHIELIASENYASPRVMEAQGSQFTNKYAEGYPGKRYYGGCEYADIVEQLAIDRAKELFGADYVNVQPHSGSQANAAVYGALINAGDTILGMDLAHGGHLTHGAKVSFSGKIYNSVLYGITADGLIDYEDVRQKALECKPKLIVAGFSAYSQVVDWAKMREIADEVGAYLFVDMAHVAGLIAAGLYLNPLPHAHVVTTTTHKTLGGPRGGLILSSCGDEEIYKKLQSSVFPANQGGPLVHIIAAKAVCFKEALEPQYKEYQANVIKNAKAMVEVFKQRGYDVVSNGTENHLFLVSFIKQGLTGKAADAALGKANITVNKNAVPNDPQKPFVTSGIRVGTPSVTRRGFNENDVRELAGWMCDVLDALGKENEEQVIAETKEKVLAICKRLPVYPK

glyA

Serine hydroxymethyltransferase

421 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

45.916 kDa

MFTRNMTIADYDPVLWQAIQDENRRQEEHIELIASENYASPRVMEAQGSQFTNKYAEGYPGKRYYGGCEYADIVEQLAIDRAKELFGADYVNVQPHSGSQANAAVYGALINAGDTILGMDLAHGGHLTHGAKVSFSGKIYNSVLYGITADGLIDYEDVRQKALECKPKLIVAGFSAYSQVVDWAKMREIADEVGAYLFVDMAHVAGLIAAGLYPNPLPHAHVVTTTTHKTLGGPRGGLILSSCGDEEIYKKLQSSVFPANQGGPLVHIIAAKAVCFKEALEPQYKEYQANVIKNAKAMVEVFKQRGYDVVSNGTENHLFLVSFIKQGLTGKAADAALGKANITVNKNAVPNDPQKPFVTSGIRVGTPSVTRRGSNENDVRELAGWMCDVLDALGKENEEQVIAETKEKVLAICKRLPVYPK

glyA

Serine hydroxymethyltransferase

421 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

45.976 kDa

MFTRNMTIADYDPVLWQAIQDENRRQEEHIELIASENYASPRVMEAQGSQFTNKYAEGYPGKRYYGGCEYADIVEQLAIDRAKELFGADYVNVQPHSGSQANAAVYGALINAGDTILGMDLAHGGHLTHGAKVSFSGKIYNSVLYGITADGLIDYEDVRQKALECKPKLIVAGFSAYSQVVDWAKMREIADEVGAYLFVDMAHVAGLIAAGLYPNPLPHAHVVTTTTHKTLGGPRGGLILSSCGDEEIYKKLQSSVFPANQGGPLVHIIAAKAVCFKEALEPQYKEYQANVIKNAKAMVEVFKQRGYDVVSNGTENHLFLVSFIKQGLTGKAADAALGKANITVNKNAVPNDPQKPFVTSGIRVGTPSVTRRGFNENDVRELAGWMCDVLDALGKENEEQVIAETKEKVLAICKRLPVYPK

glyA

Serine hydroxymethyltransferase

421 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

45.904 kDa

MFTRNMTIADYDPVLWQAIQDENRRQEEHIELIASENYASPRVMEAQGSQFTNKYAEGYPGKRYYGGCEYADIVEQLAIDRAKELFGADYVNVQPHSGSQANAAVYGALINAGDTILGMDLAHGGHLTHGAKVSFSGKIYNSVLYGITADGLIDYEDVRQKALECKPKLIVAGFSAYSQVVDWAKMREIADEVGAYLFVDMAHVAGLIAAGLYPNPLPHAHVVTTTTHKTLGGPRGGLILSSCGDEEIYKKLQSSVFPANQGGPLVHIIAAKAVCFKGALEPQYKEYQANVIKNAKAMVEVFKQRGYDVVSNGTENHLFLVSFIKQGLTGKAADAALGKANITVNKNAVPNDPQKPFVTSGIRVGTPSVTRRGFNENDVRELAGWMCDVLDALGKENEEQVIAETKEKVLAICKRLPVYPK

glyA

Serine hydroxymethyltransferase

421 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

45.983 kDa

MFTANMNIQDYDPILWQAIENENRRQEEHIELIASENYASPRVMQAQGSQFTNKYAEGYPGKRYYGGCEYADIVEQLAIDRAKQLFGADYVNVQPHSGSQANAAVYGALIQPNDTILGMDLAHGGHLTHGAKVSFSGKIYNSVLYGITAEGLIDYEDVRQKALECKPKMIVAGFSAYSQIVDWAKMREIADEVGAYLFVDMAHVAGLIAAGVYPSPLPYAHVVTTTTHKTLGGPRGGLILSACGDEEIYKKLQSSVFPANQGGPLVHIIAAKAVCFKEALEPEYKIYQQNVVKNAKAMVEVFKQRSYEVISNGTENHLFLVSFVKQGLTGKAADAALGQANITVNKNSVPNDPQKPFITSGIRIGTPAVTRRGFKEADVQALAGWMCDVLDSIGKDNHEQVIAETKAKVLDICARLPVYAK

glyA

Serine hydroxymethyltransferase

421 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

45.953 kDa

MFTANMNIQDYDPILWQAIENENRRQEEHIELIASENYASPRVMQAQGSQFTNKYAEGYPGKRYYGGCEYADIVEQLAIDRAKQLFGADYVNVQPHSGSQANAAVYGALIQPNDTILGMDLAHGGHLTHGAKVSFSGKIYNSVLYGITAEGLIDYEDVRQKALECKPKMIVAGFSAYSQIVDWAKMREIADEVGAYLFVDMAHVAGLIAAGVYPSPLPYAHVVTTTTHKTLGGPRGGLILSACGDEEIYKKLQSSVFPANQGGPLVHIIAAKAVCFKEALEPEYKIYQQNVVKNAKAMVEVFKQRGYEVISNGTENHLFLVSFVKQGLTGKAADAALGQANITVNKNSVPNDPQKPFITSGIRIGTPAVTRRGFKEADVQALAGWMCDVLDSIGKDNHEQVIAETKAKVLDICARLPVYAK

glyA

Serine hydroxymethyltransferase

421 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

45.953 kDa

MFTANMNIQDYDPILWQAIENENRRQEEHIELIASENYASPRVMQAQGSQFTNKYAEGYPGKRYYGGCEYADIVEQLAIDRAKQLFGADYVNVQPHSGSQANAAVYGALIQPNDTILGMDLAHGGHLTHGAKVSFSGKIYNSVLYGITAEGLIDYEDVRQKALECKPKMIVAGFSAYSQIVDWAKMREIADEVGAYLFVDMAHVAGLIAAGVYPSPLPYAHVVTTTTHKTLGGPRGGLILSACGDEEIYKKLQSSVFPANQGGPLVHIIAAKAVCFKEALEPEYKIYQQNVVKNAKAMVEVFKQRGYEVISNGTENHLFLVSFVKQGLTGKAADAALGQANITVNKNSVPNDPQKPFITSGIRIGTPAVTRRGFKEADVQALAGWMCDVLDSIGKDNHEQVIAETKAKVLDICARLPVYAK

glyA

Serine hydroxymethyltransferase

421 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

45.183 kDa

MFNRDMNIADYDPELWQSITDEVQRQEDHIELIASENYTSPRVMEAQGSQLTNKYAEGYPGKRYYGGCEYVDVAESLAIERAKSLFGADYANVQPHSGSQANAAVYQALCAPGDTILGMSLAHGGHLTHGSHVSFSGKMYNAVQYGITPETGILDYAEIERLAVEHKPTMIIAGFSAYSGIVDWAKFREIADKVGAYLFVDMAHVAGLVAAGLYPNPVPFADVVTTTTHKTLGGPRGGLILAKANEAIEKKLNSAVFPGQQGGPLMHVIAAKAVAFKECAEPEFAVYQQQVLDNAKAMVKSFLARGYKIVSGGTENHLFLVDLIAQDITGKEADAALGNAHITVNKNSVPNDPRSPFVTSGLRIGTPALARRGVNAQQSAELALWMCDVLDAIKDEAKLATTITAVKVKVAALCKACPVYG

glyA

Serine hydroxymethyltransferase

420 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

45.544 kDa

MLQNHSIAEFDPVLWDAIQNENRRQEEHIELIASENYVTKAVMEAQGSQLTNKYAEGYPGKRYYGGCEYVDIVEQLAIDRAKELFGADYANVQPHSGSQANAAVYGALLNAGDTILGMDLAHGGHLTHGAKVSFSGKIYNSVLYGITAEGLIDYEDVRVKALESKPKMIVAGFSAYSQVVDWAKMREIADEVGAYLFVDMAHVAGLIAAGLYPNPLPHAHVVTTTTHKTLAGPRGGLILSACGDEEIYKKLNSSVFPANQGGPLMHVIAAKAVCFKEALQPEFKAYQAQVLKNAKAMVEVFKQRGFEVVSKGTENHLFLVSFVKQGLTGKAADAALGEANITVNKNSVPNDPQKPFITSGIRVGSPSITRRGFNEADASTLAGWMCDVLESIGKDNYDQVIAETRAKVLEICKRLPVYGD

glyA

Serine hydroxymethyltransferase

420 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

45.538 kDa

MIFDQEDYKAFDPEIWEAVAKEEERQQHNIELIASENVVSKAVMAAQGSILTNKYAEGYPGRRYYGGTDVVDVIESLAIERAKEIFGAKFANVQPHSGSQANCAAYMALIEPGDTVMGMDLSAGGHLTHGASVSFSGQTYNFVSYSVDPETELLDFDAILKQAKEVQPKLIVAGASAYSHIIDFSKFREIADAVGAKLMVDMAHIAGLVAAGLHPSPVPYADITTTTTHKTLRGPRGGLILTNDEDLAKKINSAIFPGIQGGPLEHVIAAKAVAFKEVLDPAFKVYAQQILDNAQAMAQVFRQHDKFRVISDGTENHLFLVDVTKVVENGKVAQNLLDEVNITLNKNSIPYETLSPFKTSGIRIGTAAIAARGFGVTESIKVAELIIKALENAENEAVLNQVRAEVRELTDAFPLYEGLN

glyA

Serine hydroxymethyltransferase

420 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

46.17 kDa

MIFDKDNYEEYDREVWEAIHAEEKRQQNNIELIASENVVSKAVMKAQGSILTNKYAEGYPGRRYYGGTDYVDVVESLAIERAKKLFGAKYANVQPHSGSQANAAAYMALIKPGDTVMGLDLAAGGHLTHGSPVSFSGQTYNFIAYNVDPETEVLNYEQILKQAEEVQPKLIVAGASAYSHIIDFKKFRDIADQVGAKLMVDMAHIAGLVAAGLHPNPLPYAHITTTTTHKTLRGPRGGLVLTNDEDLAKKINSAIFPGLQGGPLEHIVAAKAITFKENLDPAFKVYAQKIIENCQAMVEVFNAHEKFRVVSGASENHLFLVDVTQVVENGKVAQNILDDVHITLNKNSIPFEKLSPFKTSGIRIGTAAVTARGFGPEECRKVAELIVKTLENTENEAVLEEVRQEVKLLTDAFPLYENLV

glyA

Serine hydroxymethyltransferase

420 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

45.32 kDa

MTMIFDKGNVEDFDKELWDAIHAEEERQEHHIELIASENMVSKAVMAAQGSVLTNKYAEGYPGNRYYGGTECVDIVETLAIERAKKLFGAAFANVQAHSGSQANAAAYMALIEAGDTVLGMDLAAGGHLTHGSPVNFSGKTYHFVGYSVDADTEMLNYEAILEQAKAVQPKLIVAGASAYSRSIDFEKFRAIADHVGAYLMVDMAHIAGLVAAGVHPSPVHYAHIVTSTTHKTLRGPRGGLILTNDEALAKKINSAVFPGLQGGPLEHVIAAKAVAFKEALDPAFKDYAQAIIDNTAAMAAVFAQDDRFRLISGGTDNHVFLVDVTKVIANGKLAQNLLDEVNITLNKNAIPFETLSPFKTSGIRIGCAAITSRGMGVKESQTIAHLIIKALVNHDQETILEEVRQEVRQLTDAFPLYKK

glyA

Serine hydroxymethyltransferase

420 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

45.32 kDa

MTMIFDKGNVEDFDKELWDAIHAEEERQEHHIELIASENMVSKAVMAAQGSVLTNKYAEGYPGNRYYGGTECVDIVETLAIERAKKLFGAAFANVQAHSGSQANAAAYMALIEAGDTVLGMDLAAGGHLTHGSPVNFSGKTYHFVGYSVDADTEMLNYEAILEQAKAVQPKLIVAGASAYSRSIDFEKFRAIADHVGAYLMVDMAHIAGLVAAGVHPSPVHYAHIVTSTTHKTLRGPRGGLILTNDEALAKKINSAVFPGLQGGPLEHVIAAKAVAFKEALDPAFKDYAQAIIDNTAAMAAVFAQDDRFRLISGGTDNHVFLVDVTKVIANGKLAQNLLDEVNITLNKNAIPFETLSPFKTSGIRIGCAAITSRGMGVKESQTIAHLIIKALVNHDQETILEEVRQEVRQLTDAFPLYKK

glyA

Serine hydroxymethyltransferase

420 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

45.338 kDa

MTMIFDKGNVEDFDKELWDAIHAEEERQEHHIELIASENMVSKAVMAAQGSVLTNKYAEGYPGNRYYGGTECVDIVETLAIERAKKLFGAAFANVQAHSGSQANAAAYMALIEAGDTVLGMDLAAGGHLTHGSPVNFSGKTYHFVGYSVDADTEMLNYEAILEQAKAVQPKLIVAGASAYSRSIDFEKFRAIADHVDAYLMVDMAHIAGLVAAGVHPSPVPYAHIVTSTTHKTLRGPRGGLILTNDEALAKKINSAVFPGLQGGPLEHVIAAKAVAFKEALDPAFKDYAQAIIDNTAAMAAVFAQDDRFRLISGGTDNHVFLVDVTKVIANGKLAQNLLDEVNITLNKNAIPFETLSPFKTSGIRIGCAAITSRGMGVKESQTIAHLIIKALVNHDQETILEEVRQEVRQLTDAFPLYKK

glyA

Serine hydroxymethyltransferase

420 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

45.329 kDa

MTMIFDKGNVEDFDKELWDAIHAEEERQEHHIELIASENMVSKAVMAAQGSVLTNKYAESYPGNRYYGGTECVDIVETLAIERAKKLFGAAFANVQAHSGSQANAAAYMALIEAGDTVLGMDLAAGGHLTHGSPVNFSGKTYHFVGYSVDADTETLNYEAILEQAKAVQPKLIVAGASAYSRSIDFEKFRAIADHVGAYLMVDMAHIAGLVAAGVHPSPVPYAHIVTSTTHKTLRGPRGGLILTNDEALAKKINSAVFPGLQGGPLEHVIAAKAVAFKEALDPAFKDYAQAIIDNTAAMAAVFAQDDRFRLISGGTDNHVFLVDVTKVIANGKLAQNLLDEVNITLNKNAIPFETLSPFKTSGIRIGCAAITSRGMSVKESQTIARLIIKALVNHDQETILEEVRQEVRQLTDAFPLYKK

glyA

Serine hydroxymethyltransferase

420 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

45.32 kDa

MTMIFDKGNVEDFDKELWDAIHAEEERQEHHIELIASENMVSKAVMAAQGSVLTNKYAEGYPGNRYYGGTECVDIVETLAIERAKKLFGAAFANVQAHSGSQANAAAYMALIEAGDTVLGMDLAAGGHLTHGSPVNFSGKTYHFVGYSVDADTEMLNYEAILEQAKAVQPKLIVAGASAYSRSIDFEKFRAIADHVGAYLMVDMAHIAGLVAAGVHPSPVHYAHIVTSTTHKTLRGPRGGLILTNDEALAKKINSAVFPGLQGGPLEHVIAAKAVAFKEALDPAFKDYAQAIIDNTAAMAAVFAQDDRFRLISGGTDNHVFLVDVTKVIANGKLAQNLLDEVNITLNKNAIPFETLSPFKTSGIRIGCAAITSRGMGVKESQTIAHLIIKALVNHDQETILEEVRQEVRQLTDAFPLYKK

glyA

Serine hydroxymethyltransferase

420 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

45.538 kDa

MIFDQEDYKAFDPEIWEAVAKEEERQQHNIELIASENVVSKAVMAAQGSILTNKYAEGYPGRRYYGGTDVVDVIESLAIERAKEIFGAKFANVQPHSGSQANCAAYMALIEPGDTVMGMDLSAGGHLTHGASVSFSGQTYNFVSYSVDPETELLDFDAILKQAKEVQPKLIVAGASAYSHIIDFSKFREIADAVGAKLMVDMAHIAGLVAAGLHPSPVPYADITTTTTHKTLRGPRGGLILTNDEDLAKKINSAIFPGIQGGPLEHVIAAKAVAFKEVLDPAFKVYAQQILDNAQAMAQVFRQHDKFRVISDGTENHLFLVDVTKVVENGKVAQNLLDEVNITLNKNSIPYETLSPFKTSGIRIGTAAIAARGFGVTESIKVAELIIKALENAENEAVLNQVRAEVRELTDAFPLYEGLN

glyA

Serine hydroxymethyltransferase

420 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

46.17 kDa

MIFDKDNYEEYDREVWEAIHAEEKRQQNNIELIASENVVSKAVMKAQGSILTNKYAEGYPGRRYYGGTDYVDVVESLAIERAKKLFGAKYANVQPHSGSQANAAAYMALIKPGDTVMGLDLAAGGHLTHGSPVSFSGQTYNFIAYNVDPETEVLNYEQILKQAEEVQPKLIVAGASAYSHIIDFKKFRDIADQVGAKLMVDMAHIAGLVAAGLHPNPLPYAHITTTTTHKTLRGPRGGLVLTNDEDLAKKINSAIFPGLQGGPLEHIVAAKAITFKENLDPAFKVYAQKIIENCQAMVEVFNAHEKFRVVSGASENHLFLVDVTQVVENGKVAQNILDDVHITLNKNSIPFEKLSPFKTSGIRIGTAAVTARGFGPEECRKVAELIVKTLENTENEAVLEEVRQEVKLLTDAFPLYENLV

glyA

Serine hydroxymethyltransferase

420 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

45.32 kDa

MTMIFDKGNVEDFDKELWDAIHAEEERQEHHIELIASENMVSKAVMAAQGSVLTNKYAEGYPGNRYYGGTECVDIVETLAIERAKKLFGAAFANVQAHSGSQANAAAYMALIEAGDTVLGMDLAAGGHLTHGSPVNFSGKTYHFVGYSVDADTEMLNYEAILEQAKAVQPKLIVAGASAYSRSIDFEKFRAIADHVGAYLMVDMAHIAGLVAAGVHPSPVHYAHIVTSTTHKTLRGPRGGLILTNDEALAKKINSAVFPGLQGGPLEHVIAAKAVAFKEALDPAFKDYAQAIIDNTAAMAAVFAQDDRFRLISGGTDNHVFLVDVTKVIANGKLAQNLLDEVNITLNKNAIPFETLSPFKTSGIRIGCAAITSRGMGVKESQTIAHLIIKALVNHDQETILEEVRQEVRQLTDAFPLYKK

glyA

Serine hydroxymethyltransferase

420 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

45.32 kDa

MTMIFDKGNVEDFDKELWDAIHAEEERQEHHIELIASENMVSKAVMAAQGSVLTNKYAEGYPGNRYYGGTECVDIVETLAIERAKKLFGAAFANVQAHSGSQANAAAYMALIEAGDTVLGMDLAAGGHLTHGSPVNFSGKTYHFVGYSVDADTEMLNYEAILEQAKAVQPKLIVAGASAYSRSIDFEKFRAIADHVGAYLMVDMAHIAGLVAAGVHPSPVHYAHIVTSTTHKTLRGPRGGLILTNDEALAKKINSAVFPGLQGGPLEHVIAAKAVAFKEALDPAFKDYAQAIIDNTAAMAAVFAQDDRFRLISGGTDNHVFLVDVTKVIANGKLAQNLLDEVNITLNKNAIPFETLSPFKTSGIRIGCAAITSRGMGVKESQTIAHLIIKALVNHDQETILEEVRQEVRQLTDAFPLYKK

glyA

Serine hydroxymethyltransferase

420 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

45.338 kDa

MTMIFDKGNVEDFDKELWDAIHAEEERQEHHIELIASENMVSKAVMAAQGSVLTNKYAEGYPGNRYYGGTECVDIVETLAIERAKKLFGAAFANVQAHSGSQANAAAYMALIEAGDTVLGMDLAAGGHLTHGSPVNFSGKTYHFVGYSVDADTEMLNYEAILEQAKAVQPKLIVAGASAYSRSIDFEKFRAIADHVDAYLMVDMAHIAGLVAAGVHPSPVPYAHIVTSTTHKTLRGPRGGLILTNDEALAKKINSAVFPGLQGGPLEHVIAAKAVAFKEALDPAFKDYAQAIIDNTAAMAAVFAQDDRFRLISGGTDNHVFLVDVTKVIANGKLAQNLLDEVNITLNKNAIPFETLSPFKTSGIRIGCAAITSRGMGVKESQTIAHLIIKALVNHDQETILEEVRQEVRQLTDAFPLYKK

glyA

Serine hydroxymethyltransferase

420 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

45.329 kDa

MTMIFDKGNVEDFDKELWDAIHAEEERQEHHIELIASENMVSKAVMAAQGSVLTNKYAESYPGNRYYGGTECVDIVETLAIERAKKLFGAAFANVQAHSGSQANAAAYMALIEAGDTVLGMDLAAGGHLTHGSPVNFSGKTYHFVGYSVDADTETLNYEAILEQAKAVQPKLIVAGASAYSRSIDFEKFRAIADHVGAYLMVDMAHIAGLVAAGVHPSPVPYAHIVTSTTHKTLRGPRGGLILTNDEALAKKINSAVFPGLQGGPLEHVIAAKAVAFKEALDPAFKDYAQAIIDNTAAMAAVFAQDDRFRLISGGTDNHVFLVDVTKVIANGKLAQNLLDEVNITLNKNAIPFETLSPFKTSGIRIGCAAITSRGMSVKESQTIARLIIKALVNHDQETILEEVRQEVRQLTDAFPLYKK

glyA

Serine hydroxymethyltransferase

420 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

45.32 kDa

MTMIFDKGNVEDFDKELWDAIHAEEERQEHHIELIASENMVSKAVMAAQGSVLTNKYAEGYPGNRYYGGTECVDIVETLAIERAKKLFGAAFANVQAHSGSQANAAAYMALIEAGDTVLGMDLAAGGHLTHGSPVNFSGKTYHFVGYSVDADTEMLNYEAILEQAKAVQPKLIVAGASAYSRSIDFEKFRAIADHVGAYLMVDMAHIAGLVAAGVHPSPVHYAHIVTSTTHKTLRGPRGGLILTNDEALAKKINSAVFPGLQGGPLEHVIAAKAVAFKEALDPAFKDYAQAIIDNTAAMAAVFAQDDRFRLISGGTDNHVFLVDVTKVIANGKLAQNLLDEVNITLNKNAIPFETLSPFKTSGIRIGCAAITSRGMGVKESQTIAHLIIKALVNHDQETILEEVRQEVRQLTDAFPLYKK

glyA

Serine hydroxymethyltransferase

420 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

46.198 kDa

MNILNNNLYGMDKEIYEIIKNEKLRQNNVIELIASENFVSSAVLEAQGSILTNKYAEGYPSKRFYNGCDEVDKAEVLAIERAKKLFNCKYANVQPHSGSQANQAVYLALLQPCDTILGMSLDSGGHLTHGAAPNISGKWFNTVAYNVDKETYLIDYDEIKRLAVLHNPKLLIAGFSAYPRKIDFARFREIADKVGAYLMADIAHIAGLVATGEHQSPIPYAHVVTSTTHKTLRGPRGGLILSDYEEIGKKINSALFPGLQGGPLMHVIAAKAVAFLENLQPEYKCYIKQVISNAKALAISLQERGYDILTGGTDNHIVLVDLRKDGITGKCAANSLDRAGITCNKNAIPFDTTSPFVTSGIRFGTSACTTKGFKEKDFVLIGHMVAEILDGLKNNEDNSKTEQKVLSEVKKLIKLFPFYD

glyA

Serine hydroxymethyltransferase

420 amino acids

Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.