Description
Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.
Family
Belongs to the SHMT family.
Species
Clavibacter michiganensis subsp. sepedonicus (strain ATCC 33113 / DSM 20744 / JCM 9667 / LMG 2889 / C-1)
Sequence
MPVDQSFNAPLSEVDPEIAAVLEQELGRQRGTLEMIASENFVPRAVLQSQGSVLTNKYAEGYPGRRYYGGCEFVDVAEQLAIDRAKSLFGAEFANVQPHSGATANAAVLAAIAQPGDTILGLELAHGGHLTHGMKLNFSGKLYDAAAYGVDPDTFLIDMDVVREKALEHRPQVIIAGWSAYPRHLDFAAFRSIADEVGAKLWVDMAHFAGLVAAGVHPSPVPYADVVSSTVHKTLAGPRSGVILSRDTALAKKLNSAVFPGQQGGPLMHVIAAKATAFKIAATEEFADRQRRTIQGAQILAERLVAADSTEAGVSVLTGGTDVHLVLADLRNSPIDGKQAEDALHEVGITVNRNSVPFDPRPPMVTSGVRIGTSALATRGFGETEFTEVADIIAETLKPGSDLAALRARVLTLTDGFPLYEGLTQ
Simulated SDS-PAGE

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service