About Products Protein Database Contact

Protein expression services for glyA | Serine hydroxymethyltransferase

Description
Catalyzes the reversible interconversion of serine and glycine with the modified folate sulfopterin serving as the one-carbon carrier. Cannot use tetrahydrofolate (THF or H4PteGlu) as the pteridine substrate. Also exhibits a pteridine-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism. Thus, is able to catalyze the cleavage of both allo-threonine and beta-phenylserine.
Family
Belongs to the SHMT family.
Species
Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
Length
433 amino acids
Sequence
MSLPKELEKVLEITKAQNVWRRTQTLNLIASENVMSPLAESVYMSDFMSRYAEGKPYKRYYQGTKYTDEIETLTMELMNEITNSKDCDLRPTSGTIANAAVFRVLAEPGDKALIAPVQAGAHVSHTKFGTLGALGIQHIEMPFDEENINVDVDKAIKMIEEVKPKFVVLGGSLYLFPHPTKELAQHVHAVGAKLVYDAAHVYGLIEGKVWSNPLKDGADIMTVSTHKTFPGPQGGAIFSDGSEVFKQVSKTIFPWFVSNHHLHRLPATAVTAIEMKYFGESYANQILRNSKALAEALAERGFKVIGENLGYTKSHQVAVDVRQFGGGNKIAKLLEDANIIVNKNLLPYDKPEDVSDPSGLRIGVQEMTRYGMKEGEMEEIAELFKKVIIDKKDVNEVKKEVIEMRRNFLEVKYTFDDMKDLEKYSSKSLKLII
Mass
48.5 kDa
Simulated SDS-PAGE
Western blot of glyA recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make glyA using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here