Catalyzes the reversible interconversion of serine and glycine with a modified folate serving as the one-carbon carrier. Also exhibits a pteridine-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.

Belongs to the SHMT family.

439 amino acids

MVIDITKKYPELKEIYELTVNHTIWRKKECINLIASENVMSPLAMLLYLNDMMHRYAEGKPFKRFYQGLKFVDELEVKAQRIIGELLETDYVELRPISGTIANATVFKAFAEHGDKAVVVPVQAGAHVSHTRYGTLGGLGIEQVEMPFNIEEWNIDVDGAKKVIEKVKPKIVILGGSLYIFPHPVKEIAEAAHSVGAKLMYDVAHVLGLITGKVWENPLKQGADILTSSTHKTFPGPQGGLIATVTKDDYKKVSKIVFPVFVSNHHLHRLAALAVTGLEMKYFGRQYAEQIVKNAKAFAEALAENGFKVIGENKGYTESHQVIIDVREHGGGAKNAKLLEEANIIVNKNMLPWDKPEDIKNPSGIRLGVQEVTRWGMKEEDMKTIAEFMRLVVIDKRDPKEIRNKVIEFRKNFLEIHYGFKISGEEETKLLKIMLHGEV

49.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make glyA using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here