Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. Appears to be specific for THF as the pteridine substrate, since the use of tetrahydromethanopterin (H4MPT) is much less efficient. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism. Thus, is able to catalyze the cleavage of L-allo-threonine and L-threo-beta-phenylserine.

Belongs to the SHMT family.

412 amino acids

MSYIEKTDPELFEAIKKEAERQEYKLNLIASENYASKAVMEAQGSILTNKYAEGYSGKRYYGGCDFVDIAEDLAIARAKKIFNAGYVNVQPHSGSGANMAVYFSVLKPGDTIMSMDLSHGGHLSHGSPVSFSGKLFNIVPYGVSKKTEMLDYSELMKKAKENKPQMIVCGASAYPREIDFKQFREIADEVGAYLLADIAHIAGLVVAGVHPSPVPYADFVTSTTHKTLRGPRGGIIISKTEELATRINKAVFPGLQGGPLMHIIAGKAVAFKEAMSEKFKQDQVQTVKNAKTLCKCLKEKGFDMVSGDTDNHLMLVNLNNMNITGKDAEAALSKAGIIANKNTVPFETRSPFITSGVRLGTPACTTRGMKETEMELIADYIETAITNSENDKILSETSDKVRELCSRFPVYC

45 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make glyA using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here