About Products Protein Database Contact

Protein expression services for glyA | Serine hydroxymethyltransferase

Description
Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.
Family
Belongs to the SHMT family.
Species
Lactobacillus sakei subsp. sakei (strain 23K)
Length
415 amino acids
Sequence
MLAKTDPVINDLIKQEENRQRHNIELIASENIVSGAVQEAQGSVLTNKYAEGYPNKRFYGGCEYIDQIETLAIERAKELFGADHVNVQPHSGSQANMAVYQALLEPGDKILGMNLTDGGHLTHGSPFNFSGQLYDFYSYGVADTNEQLDYASLAAKAQEVHPKMIVAGASAYSRTIDFPRLREIADQVGAYLMIDMAHIAGLVATGVHPSPVPYADVVTTTTHKTLRGPRGGMILCKAEYAKAIDSAIFPGIQGGPLEHVIAAKAVAFGEALQPEFTAYTKQIVANAQAMAAVFDQSDLVRVVSGGTDNHLMLLDLTNSGLNGKELQNLLDSVHITVNKNTIPFEKLSPFKTSGIRIGTPAITSRGFKEKDCEQIANLILEVIEKHDQLEAMTAISEAVLKLTDQFPITQAKFLD
Mass
45.1 kDa
Simulated SDS-PAGE
Western blot of glyA recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make glyA using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here