spaK

Sensor histidine kinase SpaK

459 amino acids

Member of the two-component regulatory system SpaK/SpaR involved in the regulation of the biosynthesis of lantibiotic subtilin. SpaK may function as a membrane-associated protein kinase that phosphorylates SpaR in response to environmental signals.

52.457 kDa

MGIGFKGRKTLLRELVKYMVTLCISLVVLALLYIFINTIAMNTGFSHPANYNEREAEKLAPKLETIDKVTADMIPDTMSYAILNKETKQKTAGTIKEKDLQLVKKKIEKKPYVNYKQKGYLVIERNNEYCVLQYSLRADFSSPLLRKYLPNYELTSICILIILLIIVISIITTYFANRLRKHFETLNVITRYIKEQNLQFTPEFTHIKEFDDVIDSLIEMRDALQSSLEALWRLEKNKKEQIGALAHEIKIPITIIKGNAELLSLSMQNEEQAEYTKYILGAGNQIEQYIYQLIHLSKTEDALTIHLEKASVDELTETLVKDISAYKGNKNINISFKKENLMKEAKIDWQLLHRALLNILTNAVDYTPEGGTVSVHAECDSEIFYFFVKDTGNGFSEMGLKKATELFYMDDKSRHSKGHYGMGLTFAKNAVNLHNGELTLGNTIAGGAEVRVKIPLRNE

spaK

Surface presentation of antigens protein SpaK

135 amino acids

Involved in a secretory pathway responsible for the surface presentation of determinants needed for the entry of Salmonella species into mammalian cells.

Belongs to the SpaK family.

14.919 kDa

MQHLDIAELVRSALEVSGCDPSLIGGIDSHSTIVLDLFALPSICISVKDDDVWIWAQLGADSMVVLQQRAYEILMTIMEGCHFARGGQLLLGEQNGELTLKALVHPDFLSDGEKFSTALNGFYNYLEVFSRSLMR

spaK

Surface presentation of antigens protein SpaK

135 amino acids

Involved in a secretory pathway responsible for the surface presentation of determinants needed for the entry of Salmonella species into mammalian cells. Chaperone specialized in the storage of effectors within the bacterial cytoplasm, maintaining them in a secretion-competent state, and allowing their immediate delivery to target cells upon contact of the bacterium with the host cells. Has been shown to chaperone SopA, SopE, SopE2 and SipA.

Belongs to the SpaK family.

14.919 kDa

MQHLDIAELVRSALEVSGCDPSLIGGIDSHSTIVLDLFALPSICISVKDDDVWIWAQLGADSMVVLQQRAYEILMTIMEGCHFARGGQLLLGEQNGELTLKALVHPDFLSDGEKFSTALNGFYNYLEVFSRSLMR

spaK

Surface presentation of antigens protein SpaK

133 amino acids

Required for surface presentation of invasion plasmid antigens. Chaperone specialized in the storage of effectors within the bacterial cytoplasm, maintaining them in a secretion-competent state, and allowing their immediate delivery to target cells upon contact of the bacterium with the host cells. Has been shown to chaperone IpaA, IpgB1, OspC3 and probably also OspB.

Belongs to the SpaK family.

15.116 kDa

MSNINLVQLVRDSLFTIGCPPSIITDLDSHSAITISLDSMPAINIALVNEQVMLWANFDAPSDVKLQSSAYNILNLMLMNFSYSINELVELHRSDEYLQLRVVIKDDYVHDGIVFAEILHEFYQRMEILNGVL

spaK

Surface presentation of antigens protein SpaK

133 amino acids

Required for surface presentation of invasion plasmid antigens. Chaperone specialized in the storage of effectors within the bacterial cytoplasm, maintaining them in a secretion-competent state, and allowing their immediate delivery to target cells upon contact of the bacterium with the host cells.

Belongs to the SpaK family.

15.188 kDa

MSNINLVQLVRDSLFTIGCPPSIITDLDSHSAITISLDSMPAINIALVNEQVMLWANFDAPSDVKLQSSAYNILNLMLMNFSYSINELVELHRSDEYLQLRVVIKDDYVHDGIVFAEILHEFYQRMEILNEVL