Involved in a secretory pathway responsible for the surface presentation of determinants needed for the entry of Salmonella species into mammalian cells. Chaperone specialized in the storage of effectors within the bacterial cytoplasm, maintaining them in a secretion-competent state, and allowing their immediate delivery to target cells upon contact of the bacterium with the host cells. Has been shown to chaperone SopA, SopE, SopE2 and SipA.

Belongs to the SpaK family.

135 amino acids

MQHLDIAELVRSALEVSGCDPSLIGGIDSHSTIVLDLFALPSICISVKDDDVWIWAQLGADSMVVLQQRAYEILMTIMEGCHFARGGQLLLGEQNGELTLKALVHPDFLSDGEKFSTALNGFYNYLEVFSRSLMR

14.9 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make spaK using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here