About Products Protein Database Contact

Protein expression services for spaK | Surface presentation of antigens protein SpaK

Description
Required for surface presentation of invasion plasmid antigens. Chaperone specialized in the storage of effectors within the bacterial cytoplasm, maintaining them in a secretion-competent state, and allowing their immediate delivery to target cells upon contact of the bacterium with the host cells. Has been shown to chaperone IpaA, IpgB1, OspC3 and probably also OspB.
Family
Belongs to the SpaK family.
Species
Shigella flexneri
Length
133 amino acids
Sequence
MSNINLVQLVRDSLFTIGCPPSIITDLDSHSAITISLDSMPAINIALVNEQVMLWANFDAPSDVKLQSSAYNILNLMLMNFSYSINELVELHRSDEYLQLRVVIKDDYVHDGIVFAEILHEFYQRMEILNGVL
Mass
15.1 kDa
Simulated SDS-PAGE
Western blot of spaK recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make spaK using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here