rio1

Serine/threonine-protein kinase rio1

574 amino acids

Required for the final endonucleolytic cleavage at site D converting 20S pre-rRNA into the mature 18S rRNA. Required for the final steps of cytoplasmic maturation of the 40S ribosomal subunit. Despite the protein kinase domain is proposed to act predominantly as an ATPase (By similarity).

Belongs to the protein kinase superfamily. RIO-type Ser/Thr kinase family.

67.27 kDa

MEDSFKNLTIENKEQQTVTTTTTTTTTTTKKIQTLEVPLRRNGDLIEFSDSDEEYYYDDDYEEIEYDSDLSDEENEDRILGIRSSIPLNKTLQPKAQALEQKYQNKINVNSIANSISSKRVIDDDSHRALPNSVQNSIKEIKKKDDKQGVRIVDKEDRATTEQVLDPRTRLMLFKMINKGAFSEINGCISTGKEANVYHAFTPNEEERAVKVYKTSILVFKDRDRYVTGEFRFRRGYSKHNPRKMVKVWAEKEFRNLTRLKNAGIPCPTPLILRNHILVMTFIGKDGYAAPRLKDATVSQEKFGVIYLDCIKMMRTLFHKCRLVHADLSEYNMLYYKNQLYIIDVSQSVEHDHPHSLDFLRMDCSNVTDFFRKKEVNTMFIQELFEFITDLTITEDNIDQYLEKMLEKIQSRGETTDEQKIQEEVFRNAYIPRTLDQIIDLDRDMEKIERGEGRDIFYQNLTGLSKDLQNIKSKNDLINDSNENKDSDDSSSDSSEDSDDDSDSDQLNEDDEKIRKLVVIDPITKMEIRLEDMPKKDRKKFVKEMNKERRKTKIPKHIKKLTKKRKAEKFGKKK

rio1

Serine/threonine-protein kinase rio1

497 amino acids

Required for the final endonucleolytic cleavage at site D converting 20S pre-rRNA into the mature 18S rRNA. Required for the final steps of cytoplasmic maturation of the 40S ribosomal subunit. Despite the protein kinase domain is proposed to act predominantly as an ATPase (By similarity).

Belongs to the protein kinase superfamily. RIO-type Ser/Thr kinase family.

57.498 kDa

MVEELKNDAQTNEEESEYSDFSDGSDNDYFREDDIDWNQASSNYSARQENFGNNSSKINSVNDHVSTLSRYVNNIKLNDRFEAEDKSSIKDKSDRATSEQVLDPRTRMILLKLINNGTISEINGCISTGKEANVYHATNEDGKHFAIKIYKTSILVFKDRDRYVSGEFRFRHGYNKRNPRKMVRLWAEKEIRNLKRVAAAGIPCPEPILLKQHVLLMSFLGDKKGWAYPKLKDIDMTPGEATKLYQLVARNMRILFHVCHLVHADLSEYNLLYHKGKVYFIDVSQSVEHDHPQSIDFLRMDILNISTFFRRLNAGCLSLPQLFKFITEEGSCEKEAMKTRLNAIYEEEPTTEEYEEEFLKTYVPRTLDEVYDIDRDTEIVNAGGVNSLVYKHLLNTDFQKLDLNDTTKNQNDQILPNETSESDDDANSISSMENEEERTSDSKSSAKQGKGNGRAKETPEEKRARKKKTKEDKAEKRKSKIPKYEKKRKLKQSGRKK

RIO1

Serine/threonine-protein kinase RIO1

484 amino acids

Required for the final endonucleolytic cleavage at site D converting 20S pre-rRNA into the mature 18S rRNA. Required for the final steps of cytoplasmic maturation of the 40S ribosomal subunit. The association with the very late 40S subunit intermediate seems to follow RIO2 association with precursors of the 40S subunit and may involve a translation-like checkpoint point cycle preceeding the binding to the 60S ribosomal subunit. Despite the protein kinase domain is proposed to act predominantly as an ATPase. The catalytic activity regulates its dynamic association with the 40S subunit. Has a role in the cell cycle where it is required for entrance into S-phase and in the control of the onset of anaphase. Appears to also be involved in the maintenance of chromosome stability and correct mitotic segregation.

Belongs to the protein kinase superfamily. RIO-type Ser/Thr kinase family.

56.122 kDa

MSLEDKFDSLSVSQGASDHINNQLLEKYSHKIKTDELSFSRAKTSKDKANRATVENVLDPRTMRFLKSMVTRGVIADLNGCLSTGKEANVYHAFAGTGKAPVIDEETGQYEVLETDGSRAEYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGVIPAPKPIEVKNNVLVMEFLSRGNGFASPKLKDYPYKNRDEIFHYYHTMVAYMRLLYQVCRLVHADLSEYNTIVHDDKLYMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEKMGISIFPERVIFQFVISETLEKFKGDYNNISALVAYIASNLPIKSTEQDEAEDEIFRSLHLVRSLGGLEERDFDRYTDGKFDLLKSLIAHDNERNFAASEQFEFDNADHECSSGTEEFSDDEEDGSSGSEEDDEEEGEYYDDDEPKVLKGKKHEDKDLKKLRKQEAKDAKREKRKTKVKKHIKKKLVKKTKSKK

RIO1

Probable serine/threonine-protein kinase RIO1 homolog

387 amino acids

Required for the final endonucleolytic cleavage at site D converting 20S pre-rRNA into the mature 18S rRNA. Required for the final steps of cytoplasmic maturation of the 40S ribosomal subunit. Despite the protein kinase domain is proposed to act predominantly as an ATPase. Has a role in the cell cycle where it is required for entrance into S-phase and in the control of the onset of anaphase. Appears to also be involved in the maintenance of chromosome stability and correct mitotic segregation (By similarity).

Belongs to the protein kinase superfamily. RIO-type Ser/Thr kinase family.

44.1 kDa

MKETRAEKRKKDKSDRATVDKVLDKRTLKVLERLQARGKLVNLQGSLCTGKESNVYLGEASTSLCSKFIKNRYSVTEEPGREGQIVPVVVKIFKTSIMSFRDRERYIRSEKRFQRFCTSNSRKLIKVWAEKEVRNLKRLNNAGIPSPEPIYLKNNILVMTQIGRCSEVAPRLRDASIKDLEGCYQQCVKIIRDMYKKAGLVHADLSEFNLLYFEGVVYVIDVGQSVEIDHDNAQRFLIMDINNINSFFSRKGVSVAKGNDLFEEISGNVIPLYLKDIDIGRDAFIPSRVSEVGNEEDLLAFAADSRSREFGSTTDSDLSSTGEASVEDSDASLGATESRGGGNIREEKKRKKKTVKELNRIRRASRISKKEKKRIFKRYIGMKKRKN

rio1

RIO-type serine/threonine-protein kinase Rio1

290 amino acids

Serine/threonine-protein kinase that is able to autophosphorylate as well as to phosphorylate proteasome subunit alpha 1 (PsmA1) in vitro (PubMed:20671954). Despite the protein kinase domain is proposed to act predominantly as an ATPase (By similarity).

Belongs to the protein kinase superfamily. RIO-type Ser/Thr kinase family.

33.008 kDa

MTDEFGMVEPQEGEAFGDEWEEIDVSDDEADRIARRKDRDFDEFRMRLKDADQFKVEQSVFDDATFAAIYKLVQDGHIDAFGGPISTGKEANVFEALGGDDADVAVKIYRINASDFRHMRDYLEGDPRFENIGHDKGQVVRAWVRKEFANLERAQRAGVRVPKPIAVQRNVLVMELVGVVDDRARRLSEVRVENPQTAYEVVREYMRRLHRAGLVHGDLSEYNLIIHDGELVVIDLGQAVTVHHPNAEEFLRRDCRNVANFFRRQGADADGDSLYEFVTGDEGEDGDGDE

rio1

RIO-type serine/threonine-protein kinase Rio1

290 amino acids

Despite the protein kinase domain is proposed to act predominantly as an ATPase (By similarity).

Belongs to the protein kinase superfamily. RIO-type Ser/Thr kinase family.

34.469 kDa

MSCYKVMPIAKNIDDELYELNKLLSEKEEFQLDREYQKEILEKERKFLEDLKTANEVFDKRTLMTLFSLLAGKHLTEYIGIVNSGKEAVVFKARKGKFYRAVKVYRVATCDFKTMSKYIQGDPRFHLRKSSRRQIIHAWVEKEFRNLRRASEIINAPKARLRRENVLVMDFVGYRGIPAPKLKDMQDLDWEKYFKIIKESMKKLYEEGELVHGDLSEYNILVKDDEPVFIDFSQSVITQHPLAHPLLIRDCINICNFFRRKRVDCNYKDLYKYITGKEIDPIDEAMIKQL

rio1

RIO-type serine/threonine-protein kinase Rio1

258 amino acids

Autophosphorylation of the rio1 protein is not necessary for maintenance of kinase activity. Prefers ATP over GTP (PubMed:16008568). The yeast ortholog is involved in ribosome biogenesis. Despite the protein kinase domain is proposed to act predominantly as an ATPase (By similarity).

Belongs to the protein kinase superfamily. RIO-type Ser/Thr kinase family.

30.095 kDa

MKDLKKIESYLDKLRIKEKDGEERKIYAEVLDGRTLKTLYKLSAKGYITAMGGVISTGKEANVFYADGVFDGKPVAMAVKIYRIETSEFDKMDEYLYGDERFDMRRISPKEKVFIWTEKEFRNLERAKEAGVSVPQPYTYMKNVLLMEFIGEDELPAPTLVELGRELKELDVEGIFNDVVENVKRLYQEAELVHADLSEYNIMYIDKVYFIDMGQAVTLRHPMAESYLERDVRNIIRFFSKYGVKADFEEMLKEVKGE

rio1

RIO-type serine/threonine-protein kinase Rio1

186 amino acids

Despite the protein kinase domain is proposed to act predominantly as an ATPase (By similarity).

Belongs to the protein kinase superfamily. RIO-type Ser/Thr kinase family.

21.739 kDa

MVFRAVSGKKFVAVKIFKMSTLKFMSIRKYIEGDQRFSKIRIDRNDIVPVWVRKEYTNLMALENAHVPAPKPIGFFKNILVMSYIGTKSGPAPQLKDVEIDEGIYDQVIDGMRRMYANRIVHADLSEYNMLFHRKVYFIDLAQAVDMDHPMAAEFLERDIVNVSNFFQKHGIETDPDKIREYIKKK