Required for the final endonucleolytic cleavage at site D converting 20S pre-rRNA into the mature 18S rRNA. Required for the final steps of cytoplasmic maturation of the 40S ribosomal subunit. Despite the protein kinase domain is proposed to act predominantly as an ATPase. Has a role in the cell cycle where it is required for entrance into S-phase and in the control of the onset of anaphase. Appears to also be involved in the maintenance of chromosome stability and correct mitotic segregation (By similarity).

Belongs to the protein kinase superfamily. RIO-type Ser/Thr kinase family.

387 amino acids

MKETRAEKRKKDKSDRATVDKVLDKRTLKVLERLQARGKLVNLQGSLCTGKESNVYLGEASTSLCSKFIKNRYSVTEEPGREGQIVPVVVKIFKTSIMSFRDRERYIRSEKRFQRFCTSNSRKLIKVWAEKEVRNLKRLNNAGIPSPEPIYLKNNILVMTQIGRCSEVAPRLRDASIKDLEGCYQQCVKIIRDMYKKAGLVHADLSEFNLLYFEGVVYVIDVGQSVEIDHDNAQRFLIMDINNINSFFSRKGVSVAKGNDLFEEISGNVIPLYLKDIDIGRDAFIPSRVSEVGNEEDLLAFAADSRSREFGSTTDSDLSSTGEASVEDSDASLGATESRGGGNIREEKKRKKKTVKELNRIRRASRISKKEKKRIFKRYIGMKKRKN

44.1 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make RIO1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here