Protein expression services for rio1 | RIO-type serine/threonine-protein kinase Rio1
Description
Autophosphorylation of the rio1 protein is not necessary for maintenance of kinase activity. Prefers ATP over GTP (PubMed:16008568). The yeast ortholog is involved in ribosome biogenesis. Despite the protein kinase domain is proposed to act predominantly as an ATPase (By similarity).
Family
Belongs to the protein kinase superfamily. RIO-type Ser/Thr kinase family.
Species
Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)
Length
258 amino acids
Sequence
MKDLKKIESYLDKLRIKEKDGEERKIYAEVLDGRTLKTLYKLSAKGYITAMGGVISTGKEANVFYADGVFDGKPVAMAVKIYRIETSEFDKMDEYLYGDERFDMRRISPKEKVFIWTEKEFRNLERAKEAGVSVPQPYTYMKNVLLMEFIGEDELPAPTLVELGRELKELDVEGIFNDVVENVKRLYQEAELVHADLSEYNIMYIDKVYFIDMGQAVTLRHPMAESYLERDVRNIIRFFSKYGVKADFEEMLKEVKGE
Mass
30.1 kDa
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make rio1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)
Order Here