Protein expression services for rio1 | RIO-type serine/threonine-protein kinase Rio1
Description
Serine/threonine-protein kinase that is able to autophosphorylate as well as to phosphorylate proteasome subunit alpha 1 (PsmA1) in vitro (PubMed:20671954). Despite the protein kinase domain is proposed to act predominantly as an ATPase (By similarity).
Family
Belongs to the protein kinase superfamily. RIO-type Ser/Thr kinase family.
Species
Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)
Length
290 amino acids
Sequence
MTDEFGMVEPQEGEAFGDEWEEIDVSDDEADRIARRKDRDFDEFRMRLKDADQFKVEQSVFDDATFAAIYKLVQDGHIDAFGGPISTGKEANVFEALGGDDADVAVKIYRINASDFRHMRDYLEGDPRFENIGHDKGQVVRAWVRKEFANLERAQRAGVRVPKPIAVQRNVLVMELVGVVDDRARRLSEVRVENPQTAYEVVREYMRRLHRAGLVHGDLSEYNLIIHDGELVVIDLGQAVTVHHPNAEEFLRRDCRNVANFFRRQGADADGDSLYEFVTGDEGEDGDGDE
Mass
33 kDa
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make rio1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)
Order Here