gar1

D-galacturonate reductase

309 amino acids

Mediates the reduction of D-galacturonate to L-galactonate, the first step in D-galacturonate catabolic process. Also has activity with D-glucuronate and DL-glyceraldehyde. No activity is observed with D-glucose, D-fructose, D-xylose, D-galactose, L-arabinose or D-mannose. Activity is seen only with NADPH and not with NADH.

Belongs to the aldo/keto reductase family.

33.997 kDa

MVATSFKLNNGLEIPAVGLGTWQSKAGEVKAAVSYALQIGYKLIDGAYCYGNEDEVGEGLKEAFAAGVKREDIFVVTKIWATYNTRVVLGLDKSLRSLGLDYVDLLLVHWPVLLNPEGNHDKFPTLPDGKRDVIWDYNHVDGWKQMEAVLATGKTKSIGVSNYSKKYLEQLLPHATVIPAVNQIENHPSLPQQEIVDFCKEKGIHIMAYSPLGSTGSPLMSADPVVKIAEKKGISPTTVLLSYHVNRGSTVLAKSVTPARIKANLEIVDLDDEDMKLLNDYSNDLASKGELKRYVYPPFGIDFGFPDKS

Gar1

H/ACA ribonucleoprotein complex subunit 1

231 amino acids

Required for ribosome biogenesis and telomere maintenance. Part of the H/ACA small nucleolar ribonucleoprotein (H/ACA snoRNP) complex, which catalyzes pseudouridylation of rRNA. This involves the isomerization of uridine such that the ribose is subsequently attached to C5, instead of the normal N1. Each rRNA can contain up to 100 pseudouridine (psi) residues, which may serve to stabilize the conformation of rRNAs. May also be required for correct processing or intranuclear trafficking of TERC, the RNA component of the telomerase reverse transcriptase (TERT) holoenzyme (By similarity).

Belongs to the GAR1 family.

23.474 kDa

MSFRGGGRGGFNRGGGGGGFNRGGGSNNHFRGGGGGGGGSFRGGGGGGGGSFRGGGRGGFGRGGGRGGFNKFQDQGPPERVVLLGEFMHPCEDDIVCKCTTEENKVPYFNAPVYLENKEQVGKVDEIFGQLRDFYFSVKLSENMKASSFKKLQKFYIDPYKLLPLQRFLPRPPGEKGPPRGGGGGGRGGRGGGRGGGGRGGGRGGGFRGGRGGGGGFRGGRGGGGFRGRGH

gar1

Probable H/ACA ribonucleoprotein complex subunit 1

230 amino acids

Required for ribosome biogenesis. Part of a complex which catalyzes pseudouridylation of rRNA. This involves the isomerization of uridine such that the ribose is subsequently attached to C5, instead of the normal N1. Pseudouridine (psi) residues may serve to stabilize the conformation of rRNAs (By similarity).

Belongs to the GAR1 family.

22.373 kDa

MSFRGGRGGFGGGDRGGRGGGRGGFGGGDRGGRGGFGGGRGGGRGGFGGDRGDRGGYASGENIEIGVFSHVCEEQIVCKLTATEQVPKFNCKVLSSSKNTIGSVDEIFGPINKVFFSVKLDSGVQATSFKENDKIFVDSNSVLPIKIFLEEPKPIAKVPKTPGAGGAGRGGRGGARGGFGGGRGGGAGRGGFGGGRGGSRGGFGGGRGGGSGFGGRGGSRGGRGGGRGGF

GAR1

H/ACA ribonucleoprotein complex subunit GAR1

227 amino acids

Non-catalytic component of the H/ACA small nucleolar ribonucleoprotein (H/ACA snoRNP), which catalyzes pseudouridylation of rRNA and is required for ribosome biogenesis. This involves the isomerization of uridine such that the ribose is subsequently attached to C5, instead of the normal N1. Pseudouridine (psi) residues may serve to stabilize the conformation of rRNAs. The H/ACA snoRNP complex also mediates pseudouridylation of other types of RNAs. The H/ACA snoRNP complex mediates pseudouridylation at position 93 in U2 snRNA.

Belongs to the GAR1 family.

22.433 kDa

MSFRGGGRGGGDRGGRGGFSSRGGRGGFGGGGRGGYANAGPPETVQPMGSFMHAVEGEMLCQSTDAKHVPYFNAPIYLENKSQIGKVDEILGPINEVFFTVKMDPGMVATSFKADDKVYISGDKLLPIERFLPKPKSLTKAPKKKGGARGGAAGGRGGFGGGRGAPRGRGGFGGGRGGARGGGFGAPRGGGRGAFGGGRGGAFSGGRGGAAGARGGFGGRGRGRGGY

gar1

H/ACA ribonucleoprotein complex subunit 1

226 amino acids

Required for ribosome biogenesis. Part of a complex which catalyzes pseudouridylation of rRNA. This involves the isomerization of uridine such that the ribose is subsequently attached to C5, instead of the normal N1. Pseudouridine (psi) residues may serve to stabilize the conformation of rRNAs (By similarity).

Belongs to the GAR1 family.

22.813 kDa

MSFRGGGGGRGGGFNRGGGGGRGGGFGGGRGGGFGGGRGGGFGGGRGGRGGFNRNQDYGPPEYVVALGEFMHPCEDEIVCKCVTEENKVPYFNAPVYLENKEQIGKVDEIFGQLRDFYFSVKLSDNMKASSFKKLQKFYIDPMKLLPLQRFLPRPPGEKGPPRGGRGGGGGRGGRGGGFRGGRGANGGGRGGFGGRGGGFGGRGGGGGGFRGGRGGGGGRGFRGGR

Gar1

H/ACA ribonucleoprotein complex subunit 1

226 amino acids

Required for ribosome biogenesis and telomere maintenance. Part of the H/ACA small nucleolar ribonucleoprotein (H/ACA snoRNP) complex, which catalyzes pseudouridylation of rRNA. This involves the isomerization of uridine such that the ribose is subsequently attached to C5, instead of the normal N1. Each rRNA can contain up to 100 pseudouridine (psi) residues, which may serve to stabilize the conformation of rRNAs. May also be required for correct processing or intranuclear trafficking of TERC, the RNA component of the telomerase reverse transcriptase (TERT) holoenzyme (By similarity).

Belongs to the GAR1 family.

23.011 kDa

MSFRGGGRGGFNRGGGGGGFNRGGGSNNHFRGGGGGGGGGGNFRGGGRGGFGRGGGRGGFNKFQDQGPPERVVLLGEFMHPCEDDIVCKCTTEENKVPYFNAPVYLENKEQIGKVDEIFGQLRDFYFSVKLSENMKASSFKKLQKFYIDPYKLLPLQRFLPRPPGEKGPPRGGGGGGGGGRGGRGGGRGGGGRGGGRGGGFRGGRGGGGGFRGGRGGGGGFRGRGH

GAR1

H/ACA ribonucleoprotein complex subunit GAR1

222 amino acids

Non-catalytic component of the H/ACA small nucleolar ribonucleoprotein (H/ACA snoRNP), which catalyzes pseudouridylation of rRNA and is required for ribosome biogenesis. This involves the isomerization of uridine such that the ribose is subsequently attached to C5, instead of the normal N1. Pseudouridine (psi) residues may serve to stabilize the conformation of rRNAs. The H/ACA snoRNP complex also mediates pseudouridylation of other types of RNAs. The H/ACA snoRNP complex mediates pseudouridylation at position 93 in U2 snRNA.

Belongs to the GAR1 family.

22.53 kDa

MSFRGGFRGGRGGSRGGFGGRGGARGGRPIQQGPPDTVLEMGEFMHPCEGDVVCRSINTKVPYFNAPIYLENKTQVGKVDEILGPLNEVYFTIKCGEGVQATSFKEGDKFYIAPDKLLPIERFIPKPKVAGPPKPKNKKKRSGAPAGRGGARGGFGGRGGSRGGFGGRGGSRGGFGGRGGSRGGFGGRGGSRGGFGGRGGSRGGFGGRGGSRGGFGGRGGRS

GAR1

H/ACA ribonucleoprotein complex subunit GAR1

221 amino acids

Non-catalytic component of the H/ACA small nucleolar ribonucleoprotein (H/ACA snoRNP), which catalyzes pseudouridylation of rRNA and is required for ribosome biogenesis. This involves the isomerization of uridine such that the ribose is subsequently attached to C5, instead of the normal N1. Pseudouridine (psi) residues may serve to stabilize the conformation of rRNAs. The H/ACA snoRNP complex also mediates pseudouridylation of other types of RNAs. The H/ACA snoRNP complex mediates pseudouridylation at position 93 in U2 snRNA.

Belongs to the GAR1 family.

22.195 kDa

MSFRGGSRGGRGTGANAGFSGGRGGFGGRGGGRGGFQQRDNGPPADVFAMGSFLHASEGEIVCESINTKIPYFNAPIYLENKTSIGKVDEILGPINQVYFTIKPTEGIQATSFKTGDKFYIGGDKLLPLEKFLPKPKPPPGAPKPKRAGGARGGRGGPMRGGRGGGRGAPRGGRGGFTPRGGSGGFSRGGGGGGFSRGGGGFTPRGGARGGSRGGFSRGGR

GAR1

H/ACA ribonucleoprotein complex subunit GAR1

219 amino acids

Non-catalytic component of the H/ACA small nucleolar ribonucleoprotein (H/ACA snoRNP), which catalyzes pseudouridylation of rRNA and is required for ribosome biogenesis. This involves the isomerization of uridine such that the ribose is subsequently attached to C5, instead of the normal N1. Pseudouridine (psi) residues may serve to stabilize the conformation of rRNAs. The H/ACA snoRNP complex also mediates pseudouridylation of other types of RNAs. The H/ACA snoRNP complex mediates pseudouridylation at position 93 in U2 snRNA.

Belongs to the GAR1 family.

22.169 kDa

MSFRGGNRGSRGGFRGNSRGGFGGRAAPQGPPDSVLEMGAFLHPCEGDIVCRSINTKIPYFNAPIYLENKTQVGKVDEILGPLNEVFFTVKCSDGVKAESFSEGDKFYIAPDKLLPIERFLPKPKVAGPPKPKRKRSGAPGGRGGFGGGRGGARGGSRGGFGGGRGGSRGGFGGSRGGFSGGRGGFSGGSRGGSRGGSRGGFGGSRGGSRGGFGGGRRF

gar1

H/ACA ribonucleoprotein complex subunit 1

218 amino acids

Required for ribosome biogenesis. Part of a complex which catalyzes pseudouridylation of rRNA. This involves the isomerization of uridine such that the ribose is subsequently attached to C5, instead of the normal N1. Pseudouridine (psi) residues may serve to stabilize the conformation of rRNAs (By similarity).

Belongs to the GAR1 family.

22.408 kDa

MSFRGRGGFNRGGGGGRGGGGFGGRGGGRGGYGQGGGRGGFGRGGGRGGFNRGGYDQGPPESVVEVGEFMHPCEDDVVCKCITQENRVPYFNAPIYLENKEQIGKVDEIFGQLRDFYFSIKLSENMKASSFKKLQKFYIDPAKLLPLQRFLPRPPGEKGPPRGGGRGGGRGGGRGRGGGRGGGGGFRGGRGGGFGGGGGFRGSRGGGFRGGRGFRGGR

GAR1

H/ACA ribonucleoprotein complex subunit 1

217 amino acids

Required for ribosome biogenesis and telomere maintenance. Part of the H/ACA small nucleolar ribonucleoprotein (H/ACA snoRNP) complex, which catalyzes pseudouridylation of rRNA. This involves the isomerization of uridine such that the ribose is subsequently attached to C5, instead of the normal N1. Each rRNA can contain up to 100 pseudouridine (psi) residues, which may serve to stabilize the conformation of rRNAs. May also be required for correct processing or intranuclear trafficking of TERC, the RNA component of the telomerase reverse transcriptase (TERT) holoenzyme.

Belongs to the GAR1 family.

22.348 kDa

MSFRGGGRGGFNRGGGGGGFNRGGSSNHFRGGGGGGGGGNFRGGGRGGFGRGGGRGGFNKGQDQGPPERVVLLGEFLHPCEDDIVCKCTTDENKVPYFNAPVYLENKEQIGKVDEIFGQLRDFYFSVKLSENMKASSFKKLQKFYIDPYKLLPLQRFLPRPPGEKGPPRGGGRGGRGGGRGGGGRGGGRGGGFRGGRGGGGGGFRGGRGGGFRGRGH

GAR1

H/ACA ribonucleoprotein complex subunit GAR1

215 amino acids

Non-catalytic component of the H/ACA small nucleolar ribonucleoprotein (H/ACA snoRNP), which catalyzes pseudouridylation of rRNA and is required for ribosome biogenesis. This involves the isomerization of uridine such that the ribose is subsequently attached to C5, instead of the normal N1. Pseudouridine (psi) residues may serve to stabilize the conformation of rRNAs. The H/ACA snoRNP complex also mediates pseudouridylation of other types of RNAs. The H/ACA snoRNP complex mediates pseudouridylation at position 93 in U2 snRNA.

Belongs to the GAR1 family.

22.109 kDa

MNRGRGGFRGGRGGRTGPSQFQQGPPDTVLEMGAFMQSCEGDIVCRSINVKIPYFNAPIYLENKTQVGKVDEILGPVNEVFFTIKPSEGVQADSFKDGDKFYIGPDKLLPLERFLPKPKEFGTKPKKKSAGGAGRGGFGGRGGARGGRGGFGGRGGSRGGFGDRGGRGGSRGGFGGRGGSRGGFGDRGGFGGRGGSRGGFGDRGGRGGGFRGGRF

GAR1

H/ACA ribonucleoprotein complex subunit GAR1

212 amino acids

Non-catalytic component of the H/ACA small nucleolar ribonucleoprotein (H/ACA snoRNP), which catalyzes pseudouridylation of rRNA and is required for ribosome biogenesis. This involves the isomerization of uridine such that the ribose is subsequently attached to C5, instead of the normal N1. Pseudouridine (psi) residues may serve to stabilize the conformation of rRNAs. The H/ACA snoRNP complex also mediates pseudouridylation of other types of RNAs. The H/ACA snoRNP complex mediates pseudouridylation at position 93 in U2 snRNA.

Belongs to the GAR1 family.

21.682 kDa

MSFRGNSRGGRGGARGGSRGGRGGFGGRQFQQGPPDSVVEMGAFMHDCEGDIVCRSINTKIPYFNAMIYLENKTEVGKVDEILGPLNEVFFTIKCAEGVKASSFKDGDKFYISPEKLLPIERFIPKPKVAGPPKPKRKRAAGGAPGRGGFGGRGGSRGGFGGRGGARGGFGGRGGARGGFGGFGGRGGSRGGFGGRGGARGGSRGGRGGKRF

GAR1

H/ACA ribonucleoprotein complex subunit GAR1

210 amino acids

Non-catalytic component of the H/ACA small nucleolar ribonucleoprotein (H/ACA snoRNP), which catalyzes pseudouridylation of rRNA and is required for ribosome biogenesis. This involves the isomerization of uridine such that the ribose is subsequently attached to C5, instead of the normal N1. Pseudouridine (psi) residues may serve to stabilize the conformation of rRNAs. The H/ACA snoRNP complex also mediates pseudouridylation of other types of RNAs. The H/ACA snoRNP complex mediates pseudouridylation at position 93 in U2 snRNA.

Belongs to the GAR1 family.

21.14 kDa

MSFRGAPRGRGGGGFGGGRGGGRGGFQQRDMGPPATVLEMGKFIHACEGEMVIESTNPKVPHFNAPIYLENKTAVGKVDEVLGPINQVYFTIKPSEGIQATSFKYGDKFYIAGEKLLPLERFLPKPKPPPGTVSKVKKPSRGGAARGGRGGPGGGFSRGGGRGGGRGGFGGSRGGGGFGGGFGGGRGGAPRGGRGGFSRGGGRGGGRGRF

gar1

H/ACA ribonucleoprotein complex subunit gar1

209 amino acids

Non-catalytic component of the H/ACA small nucleolar ribonucleoprotein (H/ACA snoRNP), which catalyzes pseudouridylation of rRNA and is required for ribosome biogenesis. This involves the isomerization of uridine such that the ribose is subsequently attached to C5, instead of the normal N1. Pseudouridine (psi) residues may serve to stabilize the conformation of rRNAs. The H/ACA snoRNP complex also mediates pseudouridylation of other types of RNAs. The H/ACA snoRNP complex mediates pseudouridylation at position 93 in U2 snRNA.

Belongs to the GAR1 family.

21.047 kDa

MSFRGGGRGGFASGANRGGNFGGRGGRGGFQAQTGPPAQVLEMGTFMHACEGEMVCESVNPKIPYFNAPIYLENKTPIGKVDEVLGPINQVYFTIKPQEGIVATSFKPGDKVYIGGDKLLPLEKFLPKPKPPPGSKPKKAVGGRGGFARGGARGGRGAPRGGRGGAPRGRGGPRGGGFGGGSFGGGGFRGGSRGGGRGGPRGGSGGFRR

GAR1

H/ACA ribonucleoprotein complex subunit GAR1

205 amino acids

Non-catalytic component of the H/ACA small nucleolar ribonucleoprotein (H/ACA snoRNP), which catalyzes pseudouridylation of rRNA and is required for ribosome biogenesis (PubMed:9303321, PubMed:9843512). This involves the isomerization of uridine such that the ribose is subsequently attached to C5, instead of the normal N1 (PubMed:9303321, PubMed:9843512). Pseudouridine (psi) residues may serve to stabilize the conformation of rRNAs (PubMed:9843512). The H/ACA snoRNP complex also mediates pseudouridylation of other types of RNAs (PubMed:21131909). The H/ACA snoRNP complex mediates pseudouridylation at position 93 in U2 snRNA (PubMed:21131909). Essential for growth (PubMed:9303321).

Belongs to the GAR1 family.

21.48 kDa

MSFRGGNRGGRGGFRGGFRGGRTGSARSFQQGPPDTVLEMGAFLHPCEGDIVCRSINTKIPYFNAPIYLENKTQVGKVDEILGPLNEVFFTIKCGDGVQATSFKEGDKFYIAADKLLPIERFLPKPKVVGPPKPKNKKKRSGAPGGRGGASMGRGGSRGGFRGGRGGSSFRGGRGGSSFRGGSRGGSFRGGSRGGSRGGFRGGRR

GAR1

H/ACA ribonucleoprotein complex subunit GAR1

203 amino acids

Non-catalytic component of the H/ACA small nucleolar ribonucleoprotein (H/ACA snoRNP), which catalyzes pseudouridylation of rRNA and is required for ribosome biogenesis. This involves the isomerization of uridine such that the ribose is subsequently attached to C5, instead of the normal N1. Pseudouridine (psi) residues may serve to stabilize the conformation of rRNAs. The H/ACA snoRNP complex also mediates pseudouridylation of other types of RNAs. The H/ACA snoRNP complex mediates pseudouridylation at position 93 in U2 snRNA.

Belongs to the GAR1 family.

20.653 kDa

MASRGGSRGRGFGTGANRGGFSARGGRGGMQQSFGPPTTVLEMGSFMHACEGEMVCESINPKIPYFNAPIYLENKTPVGKVDEVLGPINQVYFTIKPQEGIVATSFKPGDKFYIGGDKLLPLEKFLPKPKPPPGVSKPKKAAGTGRGGVRGGRGGARGGRGAPRGRGGFGGRGGGGARGGRGGGFSSRGGPRGGSRGGFRGRG

GAR1

H/ACA ribonucleoprotein complex subunit GAR1

203 amino acids

Non-catalytic component of the H/ACA small nucleolar ribonucleoprotein (H/ACA snoRNP), which catalyzes pseudouridylation of rRNA and is required for ribosome biogenesis. This involves the isomerization of uridine such that the ribose is subsequently attached to C5, instead of the normal N1. Pseudouridine (psi) residues may serve to stabilize the conformation of rRNAs. The H/ACA snoRNP complex also mediates pseudouridylation of other types of RNAs. The H/ACA snoRNP complex mediates pseudouridylation at position 93 in U2 snRNA.

Belongs to the GAR1 family.

20.819 kDa

MSGRGFSRGGGGGFRGGARGGRGGGRGGFQQRDMGPPDTVLEIGSFQHDVESEMLCSLTAPTKIPYFNAPIYLQNKTQIGKVDEILGPINEVYFTVKMEQGMLASSFKKEDKVYISGEKLLPIERFLPKPKVAGGKERGAQGGRGAPRGRGGAGSRGGRGGFSSRGGPGGRGGARGGAGGRGGFSSRGGGAPRGRGGFRGRGQ

GAR1

H/ACA ribonucleoprotein complex subunit GAR1

203 amino acids

Non-catalytic component of the H/ACA small nucleolar ribonucleoprotein (H/ACA snoRNP), which catalyzes pseudouridylation of rRNA and is required for ribosome biogenesis. This involves the isomerization of uridine such that the ribose is subsequently attached to C5, instead of the normal N1. Pseudouridine (psi) residues may serve to stabilize the conformation of rRNAs. The H/ACA snoRNP complex also mediates pseudouridylation of other types of RNAs. The H/ACA snoRNP complex mediates pseudouridylation at position 93 in U2 snRNA.

Belongs to the GAR1 family.

20.819 kDa

MSGRGFSRGGGGGFRGGARGGRGGGRGGFQQRDMGPPDTVLEIGSFQHDVESEMLCSLTAPTKIPYFNAPIYLQNKTQIGKVDEILGPINEVYFTVKMEQGMLASSFKKEDKVYISGEKLLPIERFLPKPKVAGGKERGAQGGRGAPRGRGGAGSRGGRGGFSSRGGPGGRGGARGGAGGRGGFSSRGGGAPRGRGGFRGRGQ

GAR1

H/ACA ribonucleoprotein complex subunit GAR1

202 amino acids

Non-catalytic component of the H/ACA small nucleolar ribonucleoprotein (H/ACA snoRNP), which catalyzes pseudouridylation of rRNA and is required for ribosome biogenesis. This involves the isomerization of uridine such that the ribose is subsequently attached to C5, instead of the normal N1. Pseudouridine (psi) residues may serve to stabilize the conformation of rRNAs. The H/ACA snoRNP complex also mediates pseudouridylation of other types of RNAs. The H/ACA snoRNP complex mediates pseudouridylation at position 93 in U2 snRNA.

Belongs to the GAR1 family.

20.676 kDa

MNRGRGGFRGGRGGRTGPSQFQQGPPDTVLEMGAFMQACEGDIVCRSINVKIPYFNAPIYLENKTQIGKVDEILGPLNEVFFTIKPSEGVKADSFKEGDKFFIGPDKLLPLERFLPKPKEVGPKPKRKSGGAGGASRGGFGGRGGARGGFGGRGGARGGFGGRGGSRGGFSGGRGGSRGGFGGRGGSRGGFGGSRGGRGGRF

gar1

H/ACA ribonucleoprotein complex subunit gar1

194 amino acids

Non-catalytic component of the H/ACA small nucleolar ribonucleoprotein (H/ACA snoRNP), which catalyzes pseudouridylation of rRNA and is required for ribosome biogenesis. This involves the isomerization of uridine such that the ribose is subsequently attached to C5, instead of the normal N1. Pseudouridine (psi) residues may serve to stabilize the conformation of rRNAs. The H/ACA snoRNP complex also mediates pseudouridylation of other types of RNAs. The H/ACA snoRNP complex mediates pseudouridylation at position 93 in U2 snRNA.

Belongs to the GAR1 family.

20.131 kDa

MSFRGGRGGGFRGGRGGSRPFTPSGPPDQVIELGLFMHDCEGEMVCQSTNVKIPYFNAPIYLENKSQIGKIDEVFGPMNQVYFTVKPSEGIVSSSFKVGDKVYLSGDKLIPLDRFLPKPKTVGPKKPKGARNGPAGRGGRGGFRGGRGGSRGGFGGNSRGGFGGGSRGGFGGGSRGGSRGGFRGGSRGGFRGRF

GAR1

H/ACA ribonucleoprotein complex subunit GAR1

182 amino acids

Non-catalytic component of the H/ACA small nucleolar ribonucleoprotein (H/ACA snoRNP), which catalyzes pseudouridylation of rRNA and is required for ribosome biogenesis. This involves the isomerization of uridine such that the ribose is subsequently attached to C5, instead of the normal N1. Pseudouridine (psi) residues may serve to stabilize the conformation of rRNAs. The H/ACA snoRNP complex also mediates pseudouridylation of other types of RNAs. The H/ACA snoRNP complex mediates pseudouridylation at position 93 in U2 snRNA.

Belongs to the GAR1 family.

20.773 kDa

MARNFNNRKRLKSTETAELGKILYMCQGQLVIKLAAKDIPYPNSPVLDASSKIIGKVDEILGRIDDVHVTIKPDDQCSISKEGETLFSYADKFIPKKRFLPREETEKKKEEMDRIKPKPKKDQASKGNRPRAFGGKQRGSDRKPDRKWGVIQSNWSKGGRKAESRKDHGSKRPDANRVKPRN