Required for ribosome biogenesis. Part of a complex which catalyzes pseudouridylation of rRNA. This involves the isomerization of uridine such that the ribose is subsequently attached to C5, instead of the normal N1. Pseudouridine (psi) residues may serve to stabilize the conformation of rRNAs (By similarity).

Belongs to the GAR1 family.

230 amino acids

MSFRGGRGGFGGGDRGGRGGGRGGFGGGDRGGRGGFGGGRGGGRGGFGGDRGDRGGYASGENIEIGVFSHVCEEQIVCKLTATEQVPKFNCKVLSSSKNTIGSVDEIFGPINKVFFSVKLDSGVQATSFKENDKIFVDSNSVLPIKIFLEEPKPIAKVPKTPGAGGAGRGGRGGARGGFGGGRGGGAGRGGFGGGRGGSRGGFGGGRGGGSGFGGRGGSRGGRGGGRGGF

22.4 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make gar1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here