About Products Protein Database Contact

Protein expression services for GAR1 | H/ACA ribonucleoprotein complex subunit GAR1

Description
Non-catalytic component of the H/ACA small nucleolar ribonucleoprotein (H/ACA snoRNP), which catalyzes pseudouridylation of rRNA and is required for ribosome biogenesis. This involves the isomerization of uridine such that the ribose is subsequently attached to C5, instead of the normal N1. Pseudouridine (psi) residues may serve to stabilize the conformation of rRNAs. The H/ACA snoRNP complex also mediates pseudouridylation of other types of RNAs. The H/ACA snoRNP complex mediates pseudouridylation at position 93 in U2 snRNA.
Family
Belongs to the GAR1 family.
Species
Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)
Length
203 amino acids
Sequence
MSGRGFSRGGGGGFRGGARGGRGGGRGGFQQRDMGPPDTVLEIGSFQHDVESEMLCSLTAPTKIPYFNAPIYLQNKTQIGKVDEILGPINEVYFTVKMEQGMLASSFKKEDKVYISGEKLLPIERFLPKPKVAGGKERGAQGGRGAPRGRGGAGSRGGRGGFSSRGGPGGRGGARGGAGGRGGFSSRGGGAPRGRGGFRGRGQ
Mass
20.8 kDa
Simulated SDS-PAGE
Western blot of GAR1 recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make GAR1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here