Description
Non-catalytic component of the H/ACA small nucleolar ribonucleoprotein (H/ACA snoRNP), which catalyzes pseudouridylation of rRNA and is required for ribosome biogenesis. This involves the isomerization of uridine such that the ribose is subsequently attached to C5, instead of the normal N1. Pseudouridine (psi) residues may serve to stabilize the conformation of rRNAs. The H/ACA snoRNP complex also mediates pseudouridylation of other types of RNAs. The H/ACA snoRNP complex mediates pseudouridylation at position 93 in U2 snRNA.
Family
Belongs to the GAR1 family.
Species
Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37)
Sequence
MSFRGGNRGSRGGFRGNSRGGFGGRAAPQGPPDSVLEMGAFLHPCEGDIVCRSINTKIPYFNAPIYLENKTQVGKVDEILGPLNEVFFTVKCSDGVKAESFSEGDKFYIAPDKLLPIERFLPKPKVAGPPKPKRKRSGAPGGRGGFGGGRGGARGGSRGGFGGGRGGSRGGFGGSRGGFSGGRGGFSGGSRGGSRGGSRGGFGGSRGGSRGGFGGGRRF
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service