RGS16

Regulator of G-protein signaling 16

202 amino acids

Regulates G protein-coupled receptor signaling cascades. Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits, thereby driving them into their inactive GDP-bound form. Plays an important role in the phototransduction cascade by regulating the lifetime and effective concentration of activated transducin alpha. May regulate extra and intracellular mitogenic signals.

22.636 kDa

MCRTLAAFPTSCLERAKEFKTRLGIFLHKSELGSDTGSVGKFEWGSKHSKEGKNFSEDVLGWKESFDLLLSSKNGVAAFHAFLKTEFSEENLEFWLACEEFKKLRSATKLGSRAHRIFEEFICSEAPKEVNIDHETRELTRTNLQAATAVCFDAAQWKVRALMEKDSYPRFLKSPAYRDLATQATAASASPSSSSPAEPLHT

RGS16

Regulator of G-protein signaling 16

202 amino acids

Regulates G protein-coupled receptor signaling cascades. Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits, thereby driving them into their inactive GDP-bound form (PubMed:11602604, PubMed:18434541). Plays an important role in the phototransduction cascade by regulating the lifetime and effective concentration of activated transducin alpha. May regulate extra and intracellular mitogenic signals (By similarity).

22.749 kDa

MCRTLAAFPTTCLERAKEFKTRLGIFLHKSELGCDTGSTGKFEWGSKHSKENRNFSEDVLGWRESFDLLLSSKNGVAAFHAFLKTEFSEENLEFWLACEEFKKIRSATKLASRAHQIFEEFICSEAPKEVNIDHETHELTRMNLQTATATCFDAAQGKTRTLMEKDSYPRFLKSPAYRDLAAQASAASATLSSCSLDEPSHT

Rgs16

Regulator of G-protein signaling 16

201 amino acids

Regulates G protein-coupled receptor signaling cascades (PubMed:9079700). Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits, thereby driving them into their inactive GDP-bound form (PubMed:10373502). Plays an important role in the phototransduction cascade by regulating the lifetime and effective concentration of activated transducin alpha (PubMed:8917514). May regulate extra and intracellular mitogenic signals.

22.691 kDa

MCRTLATFPNTCLERAKEFKTRLGIFLHKSELSSDTGGISKFEWASKHNKERSFSEDVLGWRESFDLLLNSKNGVAAFHAFLKTEFSEENLEFWLACEEFKKIRSATKLASRAHHIFDEYIRSEAPKEVNIDHETRELTKTNLQAATTSCFDVAQGKTRTLMEKDSYPRFLKSPAYRDLAAQASATSTSAPSGSPAEPSHT

RGS16

Regulator of G-protein signaling 16

200 amino acids

(Microbial infection) Gets inactivated and/or degraded by porcine circovirus 2 ORF3 protein, leading to enhanced expression of IL-6 and IL-8 in infected lymphocytes. This would explain chronic inflammatory response of PCV2 infected pigs.

22.473 kDa

MCRTLAAFPTTCLERAKEFKTRLGIFLHKSELGSDPASVGKFEWGSKHSKDGRNFSEDVLGWRESFDLLLSSKNGVAAFHTFLKTEFSEENLEFWLACEEFKKLRSATKLASRAHRIFEEFIRSEAPKEVNLDHETRELTRTNLQAATATCFDVAQGKTRTLMEKDSYPRFLKSPAYRDLAAQAASASPSSGSPAEPSHT

Rgs16

Regulator of G-protein signaling 16

199 amino acids

Regulates G protein-coupled receptor signaling cascades. Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits, thereby driving them into their inactive GDP-bound form. Plays an important role in the phototransduction cascade by regulating the lifetime and effective concentration of activated transducin alpha. May regulate extra and intracellular mitogenic signals.

22.4 kDa

MCRTIATFPNTCLERAKEFKTRLGIFLHKSELSSDTGGNGKFEWASKLSKERSFSEDVLGWRESFQSLLNSKNGVAAFHAFLKTEFSEENLEFWLACEEFKKIRSATKLASRAHHIFDEYIRSEAPKEVNIDHETRELTKTNLQAATTSCFDVAQGKTRTLMEKDSYPRFLKSPAYRDLAAQASATSASGSSPAEPSHT