Regulates G protein-coupled receptor signaling cascades. Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits, thereby driving them into their inactive GDP-bound form. Plays an important role in the phototransduction cascade by regulating the lifetime and effective concentration of activated transducin alpha. May regulate extra and intracellular mitogenic signals.

202 amino acids

MCRTLAAFPTSCLERAKEFKTRLGIFLHKSELGSDTGSVGKFEWGSKHSKEGKNFSEDVLGWKESFDLLLSSKNGVAAFHAFLKTEFSEENLEFWLACEEFKKLRSATKLGSRAHRIFEEFICSEAPKEVNIDHETRELTRTNLQAATAVCFDAAQWKVRALMEKDSYPRFLKSPAYRDLATQATAASASPSSSSPAEPLHT

22.6 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make RGS16 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here