About Products Protein Database Contact

Protein expression services for Rgs16 | Regulator of G-protein signaling 16

Description
Regulates G protein-coupled receptor signaling cascades. Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits, thereby driving them into their inactive GDP-bound form. Plays an important role in the phototransduction cascade by regulating the lifetime and effective concentration of activated transducin alpha. May regulate extra and intracellular mitogenic signals.
Species
Rattus norvegicus
Length
199 amino acids
Sequence
MCRTIATFPNTCLERAKEFKTRLGIFLHKSELSSDTGGNGKFEWASKLSKERSFSEDVLGWRESFQSLLNSKNGVAAFHAFLKTEFSEENLEFWLACEEFKKIRSATKLASRAHHIFDEYIRSEAPKEVNIDHETRELTKTNLQAATTSCFDVAQGKTRTLMEKDSYPRFLKSPAYRDLAAQASATSASGSSPAEPSHT
Mass
22.4 kDa
Simulated SDS-PAGE
Western blot of Rgs16 recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make Rgs16 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here