(Microbial infection) Gets inactivated and/or degraded by porcine circovirus 2 ORF3 protein, leading to enhanced expression of IL-6 and IL-8 in infected lymphocytes. This would explain chronic inflammatory response of PCV2 infected pigs.

200 amino acids

MCRTLAAFPTTCLERAKEFKTRLGIFLHKSELGSDPASVGKFEWGSKHSKDGRNFSEDVLGWRESFDLLLSSKNGVAAFHTFLKTEFSEENLEFWLACEEFKKLRSATKLASRAHRIFEEFIRSEAPKEVNLDHETRELTRTNLQAATATCFDVAQGKTRTLMEKDSYPRFLKSPAYRDLAAQAASASPSSGSPAEPSHT

22.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make RGS16 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here