nhp6

Non-histone chromosomal protein 6 homolog

141 amino acids

DNA-binding protein that induces severe bending of DNA. Required for DNA-binding by the FACT complex, a general chromatin factor that acts to reorganize nucleosomes. The FACT complex is involved in multiple processes that require DNA as a template such as mRNA elongation, DNA replication and DNA repair (By similarity).

Belongs to the NHP6 family.

16.016 kDa

MSSSDESGSSSSESEKKVKKTPVKKPKKEPKVSKKGKKEGKKTKKKPKDENAPRRYLSPFIFFSKDHRSVIKNSHPNCSFGEIGSLLGQEWAKISAEDKKKYEKLAAEDKKRWELEKKNYDEKLKTQSQAESSSDSSDESD

NHP6

Non-histone chromosomal protein 6

116 amino acids

DNA-binding protein that induces severe bending of DNA. Required for DNA-binding by the FACT complex, a general chromatin factor that acts to reorganize nucleosomes. The FACT complex is involved in multiple processes that require DNA as a template such as mRNA elongation, DNA replication and DNA repair. Also augments the fidelity of transcription by RNA polymerase III independently of any role in the FACT complex (By similarity).

Belongs to the NHP6 family.

13.25 kDa

MPKVSTKDSKKSTASDAKKRTKKDPNKPKRALSAYMFFVQDYRERIKTENPEATFGDVGKLLGIKWREMNENEKKPYEAKAKADKERADRENADYKAEGKASKKAAKADEESDDDE

NHP6

Non-histone chromosomal protein 6

116 amino acids

DNA-binding protein that induces severe bending of DNA. Required for DNA-binding by the FACT complex, a general chromatin factor that acts to reorganize nucleosomes. The FACT complex is involved in multiple processes that require DNA as a template such as mRNA elongation, DNA replication and DNA repair. Also augments the fidelity of transcription by RNA polymerase III independently of any role in the FACT complex (By similarity).

Belongs to the NHP6 family.

13.25 kDa

MPKVSTKDSKKSTASDAKKRTKKDPNKPKRALSAYMFFVQDYRERIKTENPEATFGDVGKLLGIKWREMNENEKKPYEAKAKADKERADRENADYKAEGKASKKAAKADEESDDDE

nhp6

Non-histone chromosomal protein 6

108 amino acids

DNA-binding protein that induces severe bending of DNA. Required for DNA-binding by the FACT complex, a general chromatin factor that acts to reorganize nucleosomes. The FACT complex is involved in multiple processes that require DNA as a template such as mRNA elongation, DNA replication and DNA repair. Also augments the fidelity of transcription by RNA polymerase III independently of any role in the FACT complex (By similarity).

Belongs to the NHP6 family.

12.361 kDa

MPRAAKSSRKKDPNTPKRNMSAFMFFSIENREKMKTDNPDATFGQLGSLLGKRWKELTSTEREPYEEKARQDKERYERERKEYDTKLANGEKTGKASAPAAAAAAKEE

nhp6

Non-histone chromosomal protein 6

106 amino acids

DNA-binding protein that induces severe bending of DNA. Required for DNA-binding by the FACT complex, a general chromatin factor that acts to reorganize nucleosomes. The FACT complex is involved in multiple processes that require DNA as a template such as mRNA elongation, DNA replication and DNA repair. Also augments the fidelity of transcription by RNA polymerase III independently of any role in the FACT complex (By similarity).

Belongs to the NHP6 family.

12.016 kDa

MPKANPTRKTKATRETGGRKKKDPNAPKRGLSAYMFFANDNRDKVREENPGISFGQVGKMLGEKWKSLSDKERKPYEDKAAADKKRYEDEKAAYKAGEAEEDEESS

nhp6

Non-histone chromosomal protein 6

104 amino acids

DNA-binding protein that induces severe bending of DNA. Required for DNA-binding by the FACT complex, a general chromatin factor that acts to reorganize nucleosomes. The FACT complex is involved in multiple processes that require DNA as a template such as mRNA elongation, DNA replication and DNA repair. Also augments the fidelity of transcription by RNA polymerase III independently of any role in the FACT complex (By similarity).

Belongs to the NHP6 family.

12.078 kDa

MPKEKTSTRTKTKRVERKKKDPNAPKRGLSAYMFFANENRDKVREENPGISFGQVGKMLGERWKALSDSERRPYEEKAAADKKRYEDEKASYNAAQDEDEEESS

NHP6

Non-histone chromosomal protein 6

103 amino acids

DNA-binding protein that induces severe bending of DNA. Required for DNA-binding by the FACT complex, a general chromatin factor that acts to reorganize nucleosomes. The FACT complex is involved in multiple processes that require DNA as a template such as mRNA elongation, DNA replication and DNA repair. Also augments the fidelity of transcription by RNA polymerase III independently of any role in the FACT complex (By similarity).

Belongs to the NHP6 family.

11.57 kDa

MPKDASAPRRTRKTTGKKKKDPNAPKRALSAYMFFANDNRDAIRADNPGIAFGQVGKALGEKWKTLTDAEKVPYEEKATADKKRYEDEKAAYKANAAEFDEEE

NHP6

Non-histone chromosomal protein 6

101 amino acids

DNA-binding protein that induces severe bending of DNA. Required for DNA-binding by the FACT complex, a general chromatin factor that acts to reorganize nucleosomes. The FACT complex is involved in multiple processes that require DNA as a template such as mRNA elongation, DNA replication and DNA repair. Also augments the fidelity of transcription by RNA polymerase III independently of any role in the FACT complex (By similarity).

Belongs to the NHP6 family.

11.488 kDa

MPKAAAPAKRATRTKRAKKDPNAPKRGLSAYMFFANEQRENVREENPGISFGQVGKLLGERWKALNEKQRAPYEAKAAADKKRYEDEKQAYNADQEEEESS

NHP6

Non-histone chromosomal protein 6

99 amino acids

DNA-binding protein that induces severe bending of DNA. Required for DNA-binding by the FACT complex, a general chromatin factor that acts to reorganize nucleosomes. The FACT complex is involved in multiple processes that require DNA as a template such as mRNA elongation, DNA replication and DNA repair. Also augments the fidelity of transcription by RNA polymerase III independently of any role in the FACT complex (By similarity).

Belongs to the NHP6 family.

11.242 kDa

MAKADTKTKSSTSTQKRTTKAKKDPDAPKRPLSAYMFFSQDQRERVKNANPEAGFGEVGRLLGAKWKEMSEAEKKPYNDMANRDKARAEAEKAAYNKRR

NHP6

Non-histone chromosomal protein 6

94 amino acids

DNA-binding protein that induces severe bending of DNA. Required for DNA-binding by the FACT complex, a general chromatin factor that acts to reorganize nucleosomes. The FACT complex is involved in multiple processes that require DNA as a template such as mRNA elongation, DNA replication and DNA repair. Also augments the fidelity of transcription by RNA polymerase III independently of any role in the FACT complex (By similarity).

Belongs to the NHP6 family.

10.642 kDa

MAAAATTKKRTQRKKKDPNAPKRAMSAYMFFANENRDIVRAENPGISFGQVGRVLGEKWKALSDDEKQPYEAKAEADKKRYESEKELYNATKAA

NHP6

Non-histone chromosomal protein 6

93 amino acids

DNA-binding protein that induces severe bending of DNA. Required for DNA-binding by the FACT complex, a general chromatin factor that acts to reorganize nucleosomes. The FACT complex is involved in multiple processes that require DNA as a template such as mRNA elongation, DNA replication and DNA repair. Also augments the fidelity of transcription by RNA polymerase III independently of any role in the FACT complex (By similarity).

Belongs to the NHP6 family.

10.661 kDa

MAAPRKKTQRKKKDPNAPKRALSAYMFFANENRDIVRAENPGITFGQVGRILGEKWKALNEDEKAPYEAKAEADKKRYESEKELYIATKAQSE

NHP6

Non-histone chromosomal protein 6

92 amino acids

DNA-binding protein that induces severe bending of DNA. Required for DNA-binding by the FACT complex, a general chromatin factor that acts to reorganize nucleosomes. The FACT complex is involved in multiple processes that require DNA as a template such as mRNA elongation, DNA replication and DNA repair. Also augments the fidelity of transcription by RNA polymerase III independently of any role in the FACT complex (By similarity).

Belongs to the NHP6 family.

10.509 kDa

MAPGERKKSSRKKKDPDAPKRSLSAYMFFANENRDIVRAENPGISFGQVGKLLGEKWKALNSEDKLPYENKAEADKKRYEKEKAEYAKKNSA

NHP6

Non-histone chromosomal protein 6

92 amino acids

DNA-binding protein that induces severe bending of DNA. Required for DNA-binding by the FACT complex, a general chromatin factor that acts to reorganize nucleosomes. The FACT complex is involved in multiple processes that require DNA as a template such as mRNA elongation, DNA replication and DNA repair. Also augments the fidelity of transcription by RNA polymerase III independently of any role in the FACT complex (By similarity).

Belongs to the NHP6 family.

10.578 kDa

MAPTEKKRTTRKKKDPDAPKRSLSAYMFFANENRDIVRAENPGISFGQVGKLLGEKWKALTPEDKIPYENKADTDKKRYEKEKAEYAKKNAA