DNA-binding protein that induces severe bending of DNA. Required for DNA-binding by the FACT complex, a general chromatin factor that acts to reorganize nucleosomes. The FACT complex is involved in multiple processes that require DNA as a template such as mRNA elongation, DNA replication and DNA repair (By similarity).

Belongs to the NHP6 family.

141 amino acids

MSSSDESGSSSSESEKKVKKTPVKKPKKEPKVSKKGKKEGKKTKKKPKDENAPRRYLSPFIFFSKDHRSVIKNSHPNCSFGEIGSLLGQEWAKISAEDKKKYEKLAAEDKKRWELEKKNYDEKLKTQSQAESSSDSSDESD

16 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make nhp6 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here