About Products Protein Database Contact

Protein expression services for NHP6 | Non-histone chromosomal protein 6

Description
DNA-binding protein that induces severe bending of DNA. Required for DNA-binding by the FACT complex, a general chromatin factor that acts to reorganize nucleosomes. The FACT complex is involved in multiple processes that require DNA as a template such as mRNA elongation, DNA replication and DNA repair. Also augments the fidelity of transcription by RNA polymerase III independently of any role in the FACT complex (By similarity).
Family
Belongs to the NHP6 family.
Species
Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056)
Length
94 amino acids
Sequence
MAAAATTKKRTQRKKKDPNAPKRAMSAYMFFANENRDIVRAENPGISFGQVGRVLGEKWKALSDDEKQPYEAKAEADKKRYESEKELYNATKAA
Mass
10.6 kDa
Simulated SDS-PAGE
Western blot of NHP6 recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make NHP6 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here