FPR2

N-formyl peptide receptor 2

351 amino acids

Low affinity receptor for N-formyl-methionyl peptides, which are powerful neutrophil chemotactic factors (PubMed:1374236). Binding of FMLP to the receptor causes activation of neutrophils (PubMed:1374236). This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system (PubMed:1374236). The activation of LXA4R could result in an anti-inflammatory outcome counteracting the actions of proinflammatory signals such as LTB4 (leukotriene B4) (PubMed:9547339). Receptor for the chemokine-like protein FAM19A5, mediating FAM19A5-stimulated macrophage chemotaxis and the inhibitory effect on TNFSF11/RANKL-induced osteoclast differentiation (By similarity).

Belongs to the G-protein coupled receptor 1 family.

38.964 kDa

METNFSTPLNEYEEVSYESAGYTVLRILPLVVLGVTFVLGVLGNGLVIWVAGFRMTRTVTTICYLNLALADFSFTATLPFLIVSMAMGEKWPFGWFLCKLIHIVVDINLFGSVFLIGFIALDRCICVLHPVWAQNHRTVSLAMKVIVGPWILALVLTLPVFLFLTTVTIPNGDTYCTFNFASWGGTPEERLKVAITMLTARGIIRFVIGFSLPMSIVAICYGLIAAKIHKKGMIKSSRPLRVLTAVVASFFICWFPFQLVALLGTVWLKEMLFYGKYKIIDILVNPTSSLAFFNSCLNPMLYVFVGQDFRERLIHSLPTSLERALSEDSAPTNDTAANSASPPAETELQAM

Fpr2

Formyl peptide receptor 2

351 amino acids

High affinity receptor for N-formyl-methionyl peptides (FMLP), which are powerful neutrophil chemotactic factors (PubMed:12218158, PubMed:10477558, PubMed:19387439). Stimulates chemotaxis in immune cells to site of infection or tissue damage upon recognition of several ligands, such as FMLP, or ligand involved in cell damage, disease or inflammation (PubMed:10477558, PubMed:19497865). Receptor for the chemokine-like protein FAM19A5, mediating FAM19A5-stimulated macrophage chemotaxis and the inhibitory effect on TNFSF11/RANKL-induced osteoclast differentiation (PubMed:29138422).

Belongs to the G-protein coupled receptor 1 family.

39.422 kDa

MESNYSIHLNGSEVVVYDSTISRVLWILSMVVVSITFFLGVLGNGLVIWVAGFRMPHTVTTIWYLNLALADFSFTATLPFLLVEMAMKEKWPFGWFLCKLVHIVVDVNLFGSVFLIALIALDRCICVLHPVWAQNHRTVSLARKVVVGPWIFALILTLPIFIFLTTVRIPGGDVYCTFNFGSWAQTDEEKLNTAITFVTTRGIIRFLIGFSMPMSIVAVCYGLIAVKINRRNLVNSSRPLRVLTAVVASFFICWFPFQLVALLGTVWFKETLLSGSYKILDMFVNPTSSLAYFNSCLNPMLYVFMGQDFRERFIHSLPYSLERALSEDSGQTSDSSTSSTSPPADIELKAP

FPR2

N-formyl peptide receptor 2

348 amino acids

Low affinity receptor for N-formyl-methionyl peptides, which are powerful neutrophil chemotactic factors (By similarity). Binding of FMLP to the receptor causes activation of neutrophils (By similarity). This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system (By similarity). Receptor for the chemokine-like protein FAM19A5, mediating FAM19A5-stimulated macrophage chemotaxis and the inhibitory effect on TNFSF11/RANKL-induced osteoclast differentiation (By similarity).

Belongs to the G-protein coupled receptor 1 family.

38.581 kDa

single

NFSTPLNEHEEVSYESAGYTVLRILPLVVLGVTFVLGVLGNGLVIWVAGFRMTRTVTTICYLNLALADFSFTATLPFLIVSMAMGEKWPFGWFLCKLIHIVVDINLFGSVFLIGFIALDRCICVLHPVWAQNHRTVSLAMKVIVGPWILALVLTLPVFLFLTTVTIPNGDTYCTFNFASWGGTPEERQKVAITMLTARGIIRFVIGFSLPMSIVAICYGLIAAKIHKKGMIKSSRPLRVLTAVVASFFICWFPFQLVALLGTVWLKEMLFYGKYKIIDILVNPTSSLAFFNSCLNPMLYVFVGQDFRERLIHSLPTSLERALSEDSAPTNDTAASCASPPAETELQAM

FPR2

N-formyl peptide receptor 2

348 amino acids

Low affinity receptor for N-formyl-methionyl peptides, which are powerful neutrophil chemotactic factors (By similarity). Binding of FMLP to the receptor causes activation of neutrophils (By similarity). This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system (By similarity). Receptor for the chemokine-like protein FAM19A5, mediating FAM19A5-stimulated macrophage chemotaxis and the inhibitory effect on TNFSF11/RANKL-induced osteoclast differentiation (By similarity).

Belongs to the G-protein coupled receptor 1 family.

38.457 kDa

single

NFSTPLSEYEEVSYESAGYTVLQILPLVVLGVTFVLGVLGNGLVIWVAGFRMTRTVTTICYLNLALADFSFTATLPFLIVSMAMGEKWPFGWFLCKLIHIVVDINLFGSVFLIGFIALDRCICVLHPVWAQNHRTVSLAMKVIVGPWILALVLTLPVFLFLTTVTIPNGDTYCTFNFASWGGTPEKRLKVAITMLTARGIIRFVIGFSMPMSIVATCYGLIAAKIHKKGMIKSSRPLRVLTAVVASFFICWFPFQLVALLSTVWLKEILVDGKYKIINILVNPTSSLAFFNSCLNPMLYVFVGQDFRERLIHSLPTSLERALSEDSAPTNDTAASCASPPAETELQAM

FPR2

N-formyl peptide receptor 2

348 amino acids

Low affinity receptor for N-formyl-methionyl peptides, which are powerful neutrophil chemotactic factors (By similarity). Binding of FMLP to the receptor causes activation of neutrophils (By similarity). This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system (By similarity). Receptor for the chemokine-like protein FAM19A5, mediating FAM19A5-stimulated macrophage chemotaxis and the inhibitory effect on TNFSF11/RANKL-induced osteoclast differentiation (By similarity).

Belongs to the G-protein coupled receptor 1 family.

38.575 kDa

single

NFSTPLNEYEEGSYESAGYTVLRILPLVVLGVTFVLGVLGNGLVIWVAGFRMTRTVTTICYLNLALADFSFTATLPFLIVSMAMGEKWPFGWFLCKLIHIVVDINLFGSVFLIGFIALDRCICVLHPVWAQNHRTVSLAMKVIVGPWILALVLTLPVFLFLTTVTIPNGDTYCTFNFASWGGTPEERLKVAITLLTARGIIRFVIGFSLPMSIVAICYGLIAAKIHKKGMIKSSRPLRVLTAVVASFFICWFPFQLVALLGTVWLKEMLFYGKYKIIDILVNPTSSLAFFNCCLNPMLYVFVGQDFRERLIHSLPTSLERALSEDSAPTNDTAANCASPPAETELQAM

FPR2

N-formyl peptide receptor 2

348 amino acids

Low affinity receptor for N-formyl-methionyl peptides, which are powerful neutrophil chemotactic factors (By similarity). Binding of FMLP to the receptor causes activation of neutrophils (By similarity). This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system (By similarity). Receptor for the chemokine-like protein FAM19A5, mediating FAM19A5-stimulated macrophage chemotaxis and the inhibitory effect on TNFSF11/RANKL-induced osteoclast differentiation (By similarity).

Belongs to the G-protein coupled receptor 1 family.

38.686 kDa

single

NFSTPLNEHEEVSYESAGYTVLQILPLVVLGVTFVLGVLGNGLVIWVAGFRMTRTVTTICYLNLPLADFSFTATLPFLIVSMAMGEKWPFGWFLCKLIHIVVDINLFGSVFLIGFIALDRCICVLHPVWAQNHRTVSLAMKVIIGPWILALVLTLPVFLFLTTVTIPNGDTYCTFNFASWGGTPEERKNVAITMLTARGIIRFVIGFSMPMSIVAICYGLIAAKIHKKGMIKSSRPLRVLTAVVASFFICWFPFQLVALLSTVWLKEMLFYGKYKIINILVNPTSSLAFFNSCLNPMLYVFVGQDFRERLIRSLPTSLERALSEDSAPTNDTAAKCASPPAETELQAM

FPR2

FK506-binding protein 2

195 amino acids

PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides (By similarity).

Belongs to the FKBP-type PPIase family. FKBP2 subfamily.

20.421 kDa

MKAALFLSALASTAVGVVAEELKIDVTLPVICERKTQKGDGVHMHYRGTLKDSGKQFDASYDRGTPLSFKVGAGQVIKGWDEGLLDMCIGEKRVLTIPPEFGYGQRAIGPIPAGSTLVFETELVGIDGVPKPEKIETKVVEGAESAAEAISEATEAAATASQKVAGKVAEAIVDAAKAAKTIIADTDDAPEHEEL

FPR2

FK506-binding protein 2

185 amino acids

PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides (By similarity).

Belongs to the FKBP-type PPIase family. FKBP2 subfamily.

19.601 kDa

MQGLLLSLSLLASAAVGVLASDDLKIDVTLPVECDRVTKKGDKINVHYKGTLKSNGEKFDSSYDRQSPFSFKLGAGMVIKGWDEGLVDMCIGEKRTLTIGPSYGYGDRNVGPIPAGSTLVFETELVGIEGVPKPESIVTKSATDAPESTASAKVVEKVASVAKQAAEVVETIIADTDDTQEHNEL

FPR2

FK506-binding protein 2

144 amino acids

PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides (By similarity).

Belongs to the FKBP-type PPIase family. FKBP2 subfamily.

15.605 kDa

MARIIVLIVAFMALIAGVFATEEKLAKLQIGILKKISPEECTQKARKGDTVSVHYTGKLEDGTVFDSSVERGQPIQFPLGTGRVIPGWDQGILGMCVGEKRKLTIPPHLAYGKQGAGRVIPPDSTLIFTTELVSIDNDGDRDEL

FPR2

FK506-binding protein 2

141 amino acids

PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides (By similarity).

Belongs to the FKBP-type PPIase family. FKBP2 subfamily.

15.727 kDa

MYHPKALIIALLFTLSLILAAKSAEQLQIGVKYVPEECPVKSRKGDRLSMHYTGTLAKDGSKFDSSLDRNRPFEFTLGAGQVIKGWDQGLLDMCISEKRKLTIPSHLAYGERGHPPVIPPQSTLVFEVELLGIKNRHVDEL

FPR2

FK506-binding protein 2

141 amino acids

PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides (By similarity).

Belongs to the FKBP-type PPIase family. FKBP2 subfamily.

15.713 kDa

MYHPKALIIALLFSLSLILAAKSAEQLQIGVKYVPEECPVKSRKGDRLSMHYTGTLAKDGSKFDSSLDRNRPFEFTLGAGQVIKGWDQGLLDMCISEKRKLTIPSHLAYGERGHPPVIPPQSTLVFEVELLGIKNRHVDEL

FPR2

FK506-binding protein 2

140 amino acids

PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides (By similarity).

Belongs to the FKBP-type PPIase family. FKBP2 subfamily.

15.255 kDa

MKFTTGLSVLLFFVLQVFAEKLTELVVGVTKEPVDCKIKASKGDVVSVHYTGKLRDSGEIFDSSYNRGVPIQFKLGYSQVISGWDQGILGMCIGEGRTLHIPSELGYGSRGAGSVIPPDADLIFETELVDIQREAVDDEL

FPR2

FK506-binding protein 2

136 amino acids

PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides (By similarity).

Belongs to the FKBP-type PPIase family. FKBP2 subfamily.

14.777 kDa

MLSQIWILFTFMVCVIASKSKSDGLKFEITKKIPISKCKLKALPGDMVSVHYTGSLAENGKVFDSSLRRNEPIQFKLGAGQVIAGWEQGITGMCLGEKRTLHIPPELAYGSRGAGGVIPPNAVLDFDVELVDIARN

FPR2

Peptidyl-prolyl cis-trans isomerase FPR2

135 amino acids

PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. FKBP-13 may play a role in protein trafficking in the ER.

Belongs to the FKBP-type PPIase family. FKBP2 subfamily.

14.487 kDa

MMFNIYLFVTFFSTILAGSLSDLEIGIIKRIPVEDCLIKAMPGDKVKVHYTGSLLESGTVFDSSYSRGSPIAFELGVGRVIKGWDQGVAGMCVGEKRKLQIPSSLAYGERGVPGVIPPSADLVFDVELVDVKSAA

FPR2

FK506-binding protein 2

135 amino acids

PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides (By similarity).

Belongs to the FKBP-type PPIase family. FKBP2 subfamily.

14.605 kDa

MLLKSLFLLFLTAIAFASELQIGILTSVPDDKCKVKSKPGDLISVHYEGKLEDGTVFDSSYSRGQPISFQLGIGQVIQGWDQGLTRMCIGEKRKLTIPSHLAYGDRGVGPIPAKATLVFVAELVDIAGSSKHDEL

fpr2

FK506-binding protein 2

134 amino acids

PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides (By similarity).

Belongs to the FKBP-type PPIase family. FKBP2 subfamily.

14.638 kDa

MRILLLSALFLSLTTLVLSADLGIEKTHVVECNRKTTKGDTVHMHYRGTLAADGSEFDSSYGRNQPLKFKLGAGRVIKGWDEGLLDMCVGEKRTLTIPPEYGYGERGIGPIPGGATLIFETELVQIEGVNNDEL

fpr2

FK506-binding protein 2

134 amino acids

PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides (By similarity).

Belongs to the FKBP-type PPIase family. FKBP2 subfamily.

14.524 kDa

MRFSIFSTLLVSLATLSTAAELGIEKTHEVECTRKTVKGDTVQMHYKGTLQSDGSEFDSSYKRNSPLKFKVGSGMVIKGWDEGLLDMCIGEKRTLTIPPEYGYGSRGVGPIPGGATLIFETELVGIDGVSKDEL