PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides (By similarity).

Belongs to the FKBP-type PPIase family. FKBP2 subfamily.

144 amino acids

MARIIVLIVAFMALIAGVFATEEKLAKLQIGILKKISPEECTQKARKGDTVSVHYTGKLEDGTVFDSSVERGQPIQFPLGTGRVIPGWDQGILGMCVGEKRKLTIPPHLAYGKQGAGRVIPPDSTLIFTTELVSIDNDGDRDEL

15.6 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make FPR2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here