Description
Low affinity receptor for N-formyl-methionyl peptides, which are powerful neutrophil chemotactic factors (By similarity). Binding of FMLP to the receptor causes activation of neutrophils (By similarity). This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system (By similarity). Receptor for the chemokine-like protein FAM19A5, mediating FAM19A5-stimulated macrophage chemotaxis and the inhibitory effect on TNFSF11/RANKL-induced osteoclast differentiation (By similarity).
Family
Belongs to the G-protein coupled receptor 1 family.
Sequence
NFSTPLSEYEEVSYESAGYTVLQILPLVVLGVTFVLGVLGNGLVIWVAGFRMTRTVTTICYLNLALADFSFTATLPFLIVSMAMGEKWPFGWFLCKLIHIVVDINLFGSVFLIGFIALDRCICVLHPVWAQNHRTVSLAMKVIVGPWILALVLTLPVFLFLTTVTIPNGDTYCTFNFASWGGTPEKRLKVAITMLTARGIIRFVIGFSMPMSIVATCYGLIAAKIHKKGMIKSSRPLRVLTAVVASFFICWFPFQLVALLSTVWLKEILVDGKYKIINILVNPTSSLAFFNSCLNPMLYVFVGQDFRERLIHSLPTSLERALSEDSAPTNDTAASCASPPAETELQAM
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service