eny2

Transcription and mRNA export factor ENY2

123 amino acids

Involved in mRNA export coupled transcription activation by association with both the TREX-2 and the SAGA complexes. The transcription regulatory histone acetylation (HAT) complex SAGA is a multiprotein complex that activates transcription by remodeling chromatin and mediating histone acetylation and deubiquitination. Within the SAGA complex, participates in a subcomplex that specifically deubiquitinates histones. The SAGA complex is recruited to specific gene promoters by activators, where it is required for transcription. The TREX-2 complex functions in docking export-competent ribonucleoprotein particles (mRNPs) to the nuclear entrance of the nuclear pore complex (nuclear basket). TREX-2 participates in mRNA export and accurate chromatin positioning in the nucleus by tethering genes to the nuclear periphery (By similarity).

Belongs to the ENY2 family.

14.234 kDa

MASTTTTILPKDHIKLRSTIHQKLIESGEKERLKVLLKSKLVEGGWRDEVKIACREYIKNNQNENFKIEDLIALITPIAKKKVPPQVKADLIKRIRKFLGPNIQNHHHHHIHIQSNTPNSPHH

ENY2

Transcription and mRNA export factor ENY2

115 amino acids

Component of a deubiquitination module (DUB module) that specifically deubiquinates monoubiquinated histone H2B (H2Bub) (PubMed:29588169, PubMed:30192741). Does not seem to be a component of the TREX-2 complex (PubMed:29588169). Seems to act independently of the SAGA multiprotein complex (PubMed:30192741). The DUB module is responsible for the major H2Bub deubiquitinase activity in Arabidopsis (PubMed:30192741).

Belongs to the ENY2 family.

13.107 kDa

MKHSVNRPPTPDEDDVADGFEKDKVTLREIINVKLVESGEKENLMELVRDRLVECGWKDEMRIACREHVKKKGRKDVTVDELIRVITPKGRASVPDSVKAELLNRIQNFIVSAAL

ENY2

Transcription and mRNA export factor ENY2

104 amino acids

Involved in mRNA export coupled transcription activation by association with both the TREX-2 and the SAGA complexes. The transcription regulatory histone acetylation (HAT) complex SAGA is a multiprotein complex that activates transcription by remodeling chromatin and mediating histone acetylation and deubiquitination. Within the SAGA complex, participates in a subcomplex that specifically deubiquitinates histones. The SAGA complex is recruited to specific gene promoters by activators, where it is required for transcription. The TREX-2 complex functions in docking export-competent ribonucleoprotein particles (mRNPs) to the nuclear entrance of the nuclear pore complex (nuclear basket). TREX-2 participates in mRNA export and accurate chromatin positioning in the nucleus by tethering genes to the nuclear periphery (By similarity).

Belongs to the ENY2 family.

12.101 kDa

MADYGSDKKSRDNQMRSAINQQLVETGEREKLKELLRVRLAECGWRDQLKQLCKEIVRERGLEHVSVDDLVQDITPKARQLVPDTVKKELLQKIRNFLAQQANV

ENY2

Transcription and mRNA export factor ENY2

101 amino acids

Involved in mRNA export coupled transcription activation by association with both the TREX-2 and the SAGA complexes. The transcription regulatory histone acetylation (HAT) complex SAGA is a multiprotein complex that activates transcription by remodeling chromatin and mediating histone acetylation and deubiquitination. Within the SAGA complex, participates in a subcomplex that specifically deubiquitinates both histones H2A and H2B. The SAGA complex is recruited to specific gene promoters by activators such as MYC, where it is required for transcription. Required for nuclear receptor-mediated transactivation. As a component of the TREX-2 complex, involved in the export of mRNAs to the cytoplasm through the nuclear pores (By similarity).

Belongs to the ENY2 family.

11.529 kDa

MVVSKMNKDAQMRAAINQKLIETGERERLKELLRAKLIECGWKDQLKAHCKEVIKEKGLEHVTVDDLVAEITPKGRALVPDSVKKELLQRIRTFLAQHASL

eny2

Transcription and mRNA export factor ENY2

95 amino acids

Involved in mRNA export coupled transcription activation by association with both the TREX-2 and the SAGA complexes. The transcription regulatory histone acetylation (HAT) complex SAGA is a multiprotein complex that activates transcription by remodeling chromatin and mediating histone acetylation and deubiquitination. Within the SAGA complex, participates in a subcomplex that specifically deubiquitinates histones. The SAGA complex is recruited to specific gene promoters by activators, where it is required for transcription. The TREX-2 complex functions in docking export-competent ribonucleoprotein particles (mRNPs) to the nuclear entrance of the nuclear pore complex (nuclear basket). TREX-2 participates in mRNA export and accurate chromatin positioning in the nucleus by tethering genes to the nuclear periphery (By similarity).

Belongs to the ENY2 family.

10.813 kDa

MSKESQMRAAINQKLIEMGERERLKELLRAKLIECGWRDQLKALCKEVIKEKGIENVTVEDLVAGVTPKGRALVPDSVKKELLQRIRAFLAQHST