Protein expression services for ENY2 | Transcription and mRNA export factor ENY2
Description
Component of a deubiquitination module (DUB module) that specifically deubiquinates monoubiquinated histone H2B (H2Bub) (PubMed:29588169, PubMed:30192741). Does not seem to be a component of the TREX-2 complex (PubMed:29588169). Seems to act independently of the SAGA multiprotein complex (PubMed:30192741). The DUB module is responsible for the major H2Bub deubiquitinase activity in Arabidopsis (PubMed:30192741).
Family
Belongs to the ENY2 family.
Species
Arabidopsis thaliana
Length
115 amino acids
Sequence
MKHSVNRPPTPDEDDVADGFEKDKVTLREIINVKLVESGEKENLMELVRDRLVECGWKDEMRIACREHVKKKGRKDVTVDELIRVITPKGRASVPDSVKAELLNRIQNFIVSAAL
Mass
13.1 kDa
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make ENY2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)
Order Here