About Products Protein Database Contact

Protein expression services for ENY2 | Transcription and mRNA export factor ENY2

Description
Involved in mRNA export coupled transcription activation by association with both the TREX-2 and the SAGA complexes. The transcription regulatory histone acetylation (HAT) complex SAGA is a multiprotein complex that activates transcription by remodeling chromatin and mediating histone acetylation and deubiquitination. Within the SAGA complex, participates in a subcomplex that specifically deubiquitinates histones. The SAGA complex is recruited to specific gene promoters by activators, where it is required for transcription. The TREX-2 complex functions in docking export-competent ribonucleoprotein particles (mRNPs) to the nuclear entrance of the nuclear pore complex (nuclear basket). TREX-2 participates in mRNA export and accurate chromatin positioning in the nucleus by tethering genes to the nuclear periphery (By similarity).
Family
Belongs to the ENY2 family.
Species
Ciona intestinalis
Length
104 amino acids
Sequence
MADYGSDKKSRDNQMRSAINQQLVETGEREKLKELLRVRLAECGWRDQLKQLCKEIVRERGLEHVSVDDLVQDITPKARQLVPDTVKKELLQKIRNFLAQQANV
Mass
12.1 kDa
Simulated SDS-PAGE
Western blot of ENY2 recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make ENY2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here