brf2

Transcription factor IIIB 50 kDa subunit

519 amino acids

General activator of RNA polymerase III transcription. Factor exclusively required for RNA polymerase III transcription of genes with promoter elements upstream of the initiation sites. Contributes to the regulation of gene expression; functions as activator in the absence of oxidative stress. Down-regulates expression of target genes in response to oxidative stress. Overexpression protects cells against apoptosis in response to oxidative stress.

Belongs to the TFIIB family.

57.126 kDa

MSGAKQCPDCGSSDIVEDAHYSQDQVVCADCGCILSEGLITTTAAEESHLQAVRFADSTGENDSMTVSKLRGIVRVRNICRVLRLPDGFSDTAVSYYEQAYKHPLYHSVSIEKKEIIVGCCVYITCRQHQWPITMATICSLVYAKKELFASIFLSIVQVLKLDVPSVSLQNLVMSHCRSFKLFKDSCEVPSHYAEKLDTVSERTVQTVELAYETWLVTGRHPIPIITAAAYISWQSLLPARRLSCSLSRFCKLSDVDLPPPSAIRLRELQGTLIKLSVYLPWLKVLSLNKKTVVQHLGDLLRHRVFLLRKALAVTEAELSRGTLADTEAQLSRGTLADTEAQLSRGTLADTEAQLSRGTLADTEAQLSRGTLADTEAQLSRGTLADTEAQLSRGTLADTEAQLSRGTLADTEAQLSRGTLADTVAQLSRGTLADTEAQLSRGTKALSSNDQPNSTFVFLPPCVSNPRKRSRSIPFPRGHLDITGDEDISDSEIEQYLRTPAEMKEFEQALNRDDELPNA

brf2

Transcription factor IIIB 50 kDa subunit

423 amino acids

General activator of RNA polymerase III transcription. Factor exclusively required for RNA polymerase III transcription of genes with promoter elements upstream of the initiation sites. Contributes to the regulation of gene expression; functions as activator in the absence of oxidative stress. Down-regulates expression of target genes in response to oxidative stress. Overexpression protects cells against apoptosis in response to oxidative stress.

Belongs to the TFIIB family.

48.439 kDa

MSKNCPECGSSRVVEDDLYSQKQWVCEDCGSVVSEGLLTTTLSEESHSRAVPFFTSTAAFKKPCRNLVSGFSRLRALCRIFRLSSSMEDASANLFERAYNHPNFLHISLSKKQILAGCCMFHICRQNSWPVFMGTIGYLLDADNYQMGTIYQELTKSLNLQTTQVCITRMLESFCYDFKLAPDEVEEVFSVAQQRLVDQTSALLELAADTWILTGRRPFPLFLAAVYVAWQSLNPLARMKYSLMKFCKIAKAPEQLWCKSKDTINKRLNELLEVLCKLGRELPWVRPTDIQMNTVTTLVEDILKHRKALLILAVKHYEKQLEETQTSQYSESELSDSKSSVQTQCKSPPDEEDEGCELPPDHWGKRHLFLPPCVRTQKRQKINEAPLEVTGDEDISDSEIESYIRSEEEIKLFAKARKKICKY

BRF2

Transcription factor IIIB 50 kDa subunit

421 amino acids

General activator of RNA polymerase III transcription. Factor exclusively required for RNA polymerase III transcription of genes with promoter elements upstream of the initiation sites. Contributes to the regulation of gene expression; functions as activator in the absence of oxidative stress. Down-regulates expression of target genes in response to oxidative stress. Overexpression protects cells against apoptosis in response to oxidative stress.

Belongs to the TFIIB family.

46.591 kDa

MPGRGRCPDCGSAELVEDSHYSQNQLVCSDCGCVVTEGVLTTTFSDEGNLREVTYSRSTGENEQVSRSQQRGLRRVRDLCRVLQLPPTFEDTAVAYYQQAHQLAGIRTARLQKKEVLAGCCVLITCRQRNWPLTMGTICTLLYADLDVFSGTYMQIVKLLGLDVPSLCLVDLVKTYCSSFKLFEASPSVPAKYVEDKEKMLSRTLQLVELADETWLVTGRHPLPVITAATFLAWQSLRPSDRLTCSLARFCKLANVDLPYPASSRLQELLAVLLRMAEQLAWLQVLKLDKRSVVKHIGDLLQHRHMLVRKAFRDGTAEMDAGEKELQGQGQGQGLGDEDVGSSSLELPAGKRPSSPALLLPPCMLKPPKRVCPAPPVSMVTGDEDISDSEIEQYLRTPQEVRDFQKAQAARQAAQGTPNPP

Brf2

Transcription factor IIIB 50 kDa subunit

420 amino acids

General activator of RNA polymerase III transcription. Factor exclusively required for RNA polymerase III transcription of genes with promoter elements upstream of the initiation sites. Contributes to the regulation of gene expression; functions as activator in the absence of oxidative stress. Down-regulates expression of target genes in response to oxidative stress. Overexpression protects cells against apoptosis in response to oxidative stress.

Belongs to the TFIIB family.

47.05 kDa

MPNGSRCPDCGSSELVEDSHYSQSQLVCSDCGCVVTEGVLTTTFSDEGNFREVTYSRSTGENEQVSRCQQRDLRRVRDLCRILKLPLTFEDTAISYYQKAYQLSGIRAARLQKKEVLVGCCVLITCRQHNWPLTMGTICTLLYADLDLFSGTYMQMVKLLGLDVPSLCLADLVKSYCSSFKLFQASPSVPAKYVEDKDKMLSRTLLLVELADETWLVTGRHPLPIITAATFLAWQSLRPSDRLTCSLAQFCKLANVDLPYPAASRLQELLAVLLQMAGQLAWLQVLKLNKRSVVKHIGDLLQHRHMLVRTAFRDGTAEVETQQQQQQQQGQGQGQQDEVGDGPFDLPKRKRRASPTPLLPPCMLKPPKRTHTLPPESAVTGDEDISDSEIEQYLRTPQEVRDFERAQAASQAAMRVPNPP

BRF2

Transcription factor IIIB 50 kDa subunit

419 amino acids

General activator of RNA polymerase III transcription. Factor exclusively required for RNA polymerase III transcription of genes with promoter elements upstream of the initiation sites (PubMed:11040218, PubMed:11121026, PubMed:11564744, PubMed:26638071). Contributes to the regulation of gene expression; functions as activator in the absence of oxidative stress (PubMed:26638071). Down-regulates expression of target genes in response to oxidative stress (PubMed:26638071). Overexpression protects cells against apoptosis in response to oxidative stress (PubMed:26638071).

Belongs to the TFIIB family.

46.533 kDa

MPGRGRCPDCGSTELVEDSHYSQSQLVCSDCGCVVTEGVLTTTFSDEGNLREVTYSRSTGENEQVSRSQQRGLRRVRDLCRVLQLPPTFEDTAVAYYQQAYRHSGIRAARLQKKEVLVGCCVLITCRQHNWPLTMGAICTLLYADLDVFSSTYMQIVKLLGLDVPSLCLAELVKTYCSSFKLFQASPSVPAKYVEDKEKMLSRTMQLVELANETWLVTGRHPLPVITAATFLAWQSLQPADRLSCSLARFCKLANVDLPYPASSRLQELLAVLLRMAEQLAWLRVLRLDKRSVVKHIGDLLQHRQSLVRSAFRDGTAEVETREKEPPGWGQGQGEGEVGNNSLGLPQGKRPASPALLLPPCMLKSPKRICPVPPVSTVTGDENISDSEIEQYLRTPQEVRDFQRAQAARQAATSVPNPP

Brf2

Transcription factor IIIB 50 kDa subunit

416 amino acids

General activator of RNA polymerase III transcription. Factor exclusively required for RNA polymerase III transcription of genes with promoter elements upstream of the initiation sites. Contributes to the regulation of gene expression; functions as activator in the absence of oxidative stress. Down-regulates expression of target genes in response to oxidative stress. Overexpression protects cells against apoptosis in response to oxidative stress.

Belongs to the TFIIB family.

46.596 kDa

MPNGSRCPDCGSSELVEDSHYSQSQLVCSDCGCVVTEGVLTTTFSDEGNLREVTYSRSTGENEQVSRSQQRDLRRVRDLCRILKLPLTFEETAVSYYQKAYQLSGIRAARLQKKEVVVGCCVLITCRQHNWPLTMGAICTLLYADLDVFSSTYMQIVKLLGLDVPSLCLADLVKSYCSSFKLFQASPSMPAKYVEDKDKMLSRTLLLVELANETWLVTGRHPLPIITAATFLAWQSLRPSDRLTCSLARFCKLANVDLPYPAASRLQELLAVLLQMASQLAWLQVLRLDKRSVVKHIGDLLQHRHMLVRMAFQDGTAEVETKQQQPQGRGQQEEVGDSTFDLPKRKRPASPALLLPPCMLKPPKRTHTMPPDSVVTGDEDISDSEIEQYLRTPQEVRDFERAQAASRAAMSVPNPP

brf2

Transcription factor IIIB 50 kDa subunit

396 amino acids

General activator of RNA polymerase III transcription. Factor exclusively required for RNA polymerase III transcription of genes with promoter elements upstream of the initiation sites. Contributes to the regulation of gene expression; functions as activator in the absence of oxidative stress. Down-regulates expression of target genes in response to oxidative stress. Overexpression protects cells against apoptosis in response to oxidative stress.

Belongs to the TFIIB family.

44.43 kDa

MSGAKRCPDCGSSEIVEDAHYSQDQLVCADCGCILSEGLITTTVSEETSLQAVRYSDSTGENDSVTYCMKRGIIRVRDLCRVLRLPDGFVDTALSYYKQAVGLPLYRLVSIEKKEIIVGCCVYITCRQQQWPITMGTICSLIYAKKELFASLFMDIVQVLKVDVPSISLQNLVKSHCRSFKLFKDSSEVPPQYAEKLDTVSERTVQTVELAYETWLVTGRHPIPMITAAAYISWQSFQPSRRLSCSLSRFCKLSDVDMPPPSTIRLKELQETLIKLAYHLPWLKILSLNRKNIVQHLGDLLKHRALLLRRALAVTEAELSKGTEASSSTDQLNSTLVFLPPCVSNPKKRSRSIAFPCGDLDITGDEEISDSEIEQYLRTPAEMKDYQQVQSCISSV

BRF2

Transcription factor IIIB 50 kDa subunit

373 amino acids

General activator of RNA polymerase III transcription. Factor exclusively required for RNA polymerase III transcription of genes with promoter elements upstream of the initiation sites. Contributes to the regulation of gene expression; functions as activator in the absence of oxidative stress. Down-regulates expression of target genes in response to oxidative stress. Overexpression protects cells against apoptosis in response to oxidative stress.

Belongs to the TFIIB family.

41.818 kDa

MPGRGRCPDCGSTELVEDSHYSQSQLVCSDCGCVVTEGVLTTTFSDEGNLREVTYSRSTGENEQISRSQQRGLRRVRDLCRVLQLPPTFEDTAVAYYQQAYRHSGIRAARLQKKEVLVGCCVLITCRQHNWPLTMGAICTLLYADLDVFSSIYMQIVKLLGLDMPSLCLAELVKTYCSSFKLFQASPSVPAKYVEDKEKMLSRTLQLVELANETWLVTGRHPLPVITAATFLAWQSLQPADRLSCSLARFCKLANVDLPYPASSRLQELLAVLLRMAEQLAWLRVLRLDKRSVVKHIGDLLQHRHSLVRLAFRDGTAEVETRGKEPPPVSTVTGDENISDSEIEQYLRTPQEVRDFQRAQAARQAATSVPNPP