General activator of RNA polymerase III transcription. Factor exclusively required for RNA polymerase III transcription of genes with promoter elements upstream of the initiation sites. Contributes to the regulation of gene expression; functions as activator in the absence of oxidative stress. Down-regulates expression of target genes in response to oxidative stress. Overexpression protects cells against apoptosis in response to oxidative stress.

Belongs to the TFIIB family.

396 amino acids

MSGAKRCPDCGSSEIVEDAHYSQDQLVCADCGCILSEGLITTTVSEETSLQAVRYSDSTGENDSVTYCMKRGIIRVRDLCRVLRLPDGFVDTALSYYKQAVGLPLYRLVSIEKKEIIVGCCVYITCRQQQWPITMGTICSLIYAKKELFASLFMDIVQVLKVDVPSISLQNLVKSHCRSFKLFKDSSEVPPQYAEKLDTVSERTVQTVELAYETWLVTGRHPIPMITAAAYISWQSFQPSRRLSCSLSRFCKLSDVDMPPPSTIRLKELQETLIKLAYHLPWLKILSLNRKNIVQHLGDLLKHRALLLRRALAVTEAELSKGTEASSSTDQLNSTLVFLPPCVSNPKKRSRSIAFPCGDLDITGDEEISDSEIEQYLRTPAEMKDYQQVQSCISSV

44.4 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make brf2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here