Description
General activator of RNA polymerase III transcription. Factor exclusively required for RNA polymerase III transcription of genes with promoter elements upstream of the initiation sites. Contributes to the regulation of gene expression; functions as activator in the absence of oxidative stress. Down-regulates expression of target genes in response to oxidative stress. Overexpression protects cells against apoptosis in response to oxidative stress.
Family
Belongs to the TFIIB family.
Sequence
MPNGSRCPDCGSSELVEDSHYSQSQLVCSDCGCVVTEGVLTTTFSDEGNLREVTYSRSTGENEQVSRSQQRDLRRVRDLCRILKLPLTFEETAVSYYQKAYQLSGIRAARLQKKEVVVGCCVLITCRQHNWPLTMGAICTLLYADLDVFSSTYMQIVKLLGLDVPSLCLADLVKSYCSSFKLFQASPSMPAKYVEDKDKMLSRTLLLVELANETWLVTGRHPLPIITAATFLAWQSLRPSDRLTCSLARFCKLANVDLPYPAASRLQELLAVLLQMASQLAWLQVLRLDKRSVVKHIGDLLQHRHMLVRMAFQDGTAEVETKQQQPQGRGQQEEVGDSTFDLPKRKRPASPALLLPPCMLKPPKRTHTMPPDSVVTGDEDISDSEIEQYLRTPQEVRDFERAQAASRAAMSVPNPP
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service