yidC2

Membrane protein insertase YidC 2

320 amino acids

Required for the insertion and/or proper folding and/or complex formation of integral membrane proteins into the membrane. Involved in integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as at least some lipoproteins.

Belongs to the OXA1/ALB3/YidC family. Type 2 subfamily.

35.645 kDa

MKNLKKKLTLTGLMTAGLLFLSGCVQTHVVDGVRVPTEAATHGITYNFLVRPMSAFVDLFANNLHMGYGWGIIFVTLIIRFLILPLGLNQAYKSTYMQEKMAYLAPVFAPLQERLKKAQTPEEKMAAQQALMAAQKDNGINMLSSIGCLPMLIQWPFFIALYNAAAYTTGISSSTFYGIPLGHPSVVLVIISGVLYFIQTWISTLSMTPEQKKSGMAMLIMSPAMIVVFSFMSPAGVALYWAVGGFVIVIQQIIITFIMKPRMRRRIDEEFTKNPPKINNEGLKDVTPTSVQENFKEITSERNEKERKSGGRNAGKQNRK

yidC2

Membrane protein insertase YidC 2

310 amino acids

Required for the insertion and/or proper folding and/or complex formation of integral membrane proteins into the membrane. Involved in integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as at least some lipoproteins.

Belongs to the OXA1/ALB3/YidC family. Type 2 subfamily.

34.69 kDa

MKKTLKRILFSSLSLSILLLLTGCVSVDKAGKPYGVIWNTLGVPMANLITYFAQHQGLGFGVAIIIVTIIVRVIILPLGLYQSWKASYQAEKMAYFKPLFEPINERLRNAKTQEEKLAAQTELMTAQRENGLSMFGGIGCLPLLIQMPFFSAIFFAARYTPGVSSATFLGLNLGQKSLTLTVIIAILYFVQSWLSMQGVPDEQRQQMKTMMYVMPIAMVFMSISLPASVALYWFIGGIFSIIQQLVTTYVLKPKLRRKVEEEYTKNPPKAYKSNNARKDVTSSTKTTESNQAIITSKKTNRNAGKQKRRG

yidC2

Membrane protein insertase YidC 2

310 amino acids

Required for the insertion and/or proper folding and/or complex formation of integral membrane proteins into the membrane. Involved in integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as at least some lipoproteins.

Belongs to the OXA1/ALB3/YidC family. Type 2 subfamily.

34.735 kDa

MKKTLKRILFSSLSLSMLLLLTGCVSVDKAGKPYGVIWNTLGVPMANLITYFAQHQGLGFGVAIIIVTVIVRVVILPLGLYQSWKASYQAEKMAYFKPLFEPINERLRNAKTQEEKLAAQTELMTAQRENGLSMFGGIGCLPLLIQMPFFSAIFFAARYTPGVSSATFLGLNLGQKSLTLTVIIAILYFVQSWLSMQGVPDEQRQQMKTMMYLMPIMMVFMSISLPASVALYWFIGGIFSIIQQLVTTYVLKPKLRRKVEEEYTKNPPKAYKANNARKDVTNSTKATESNQAIITSKKTNRNAGKQKRRG

yidC2

Membrane protein insertase YidC 2

310 amino acids

Required for the insertion and/or proper folding and/or complex formation of integral membrane proteins into the membrane. Involved in integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as at least some lipoproteins (By similarity). Partially complements an E.coli yidC depletion experiment.

Belongs to the OXA1/ALB3/YidC family. Type 2 subfamily.

34.908 kDa

MKKIYKRLLFSGLALSMLFFLSGCVQMKNGKPTGEGWVYKFFAAPMGSVIQYLANNLGLGFGFAIIIVTVIVRLLILPLGLSQVRKMTYQSEKMAYLKPVFDPIQERMKNAKTQEEKMAAQTELMQAQRHYGMSMFGGLGCLPLLIQMPFFSALYISTRYTKGIASASFLGIKLGSPNMIITVIIGILYLVQSWVSTLSVPEAQRQQTRNMMFMMPIMMVMISIGAPAGGALYWLVSGIFGLIQQLITNHIIKPKLRKQIDEEFKKNPPKPFKSNARKDITPQANNDKKLITSKKQKSNRNAGKQRHHKQ

yidC2

Membrane protein insertase YidC 2

307 amino acids

Required for the insertion and/or proper folding and/or complex formation of integral membrane proteins into the membrane. Involved in integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as at least some lipoproteins.

Belongs to the OXA1/ALB3/YidC family. Type 2 subfamily.

34.506 kDa

MKLTLNRILFSGLALSILLTLTGCVGRDAHGNPKGMIWEFLGKPMSYFIDYFANNAGLGYGLAIIIVTIIVRTLILPLGLYQSWKASYQSEKMAFLKPVFEPINKRIKQANSQEEKMAAQTELMAAQRAHGINPLGGIGCLPLLIQMPFFSAMYFAAQYTKGVSTSTFMGIDLGSRSLVLTAIIAALYFFQSWLSMMAVSEEQREQMKTMMYTMPIMMIFMSFSLPAGVGLYWLVGGFFSIIQQLITTYLLKPRLHKQIKEEYAKNPPKAYQSTSSRKDVTPSQNMEQANLPKKIKSNRNAGKQRKR

yidC2

Membrane protein insertase YidC 2

307 amino acids

Required for the insertion and/or proper folding and/or complex formation of integral membrane proteins into the membrane. Involved in integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as at least some lipoproteins.

Belongs to the OXA1/ALB3/YidC family. Type 2 subfamily.

34.54 kDa

MKLTLNRILFSGLALSILFTLTGCVGRDAHGNPKGMIWEFLGKPMSYFIDYFANNAGLGYGLAIIIVTIIVRTLILPLGLYQSWKASYQSEKMAFLKPVFEPINKRIKQANSQEEKMAAQTELMAAQRAHGINPLGGIGCLPLLIQMPFFSAMYFAAQYTKGVSTSTFMGIDLGSRSLVLTAIIAALYFFQSWLSMMAVSEEQREQMKTMMYTMPIMMIFMSFSLPAGVGLYWLVGGFFSIIQQLITTYLLKPRLHKQIKEEYAKNPPKAYQSTSSRKDVTPSQNMEQANLPKKIKSNRNAGKQRKR

yidC2

Membrane protein insertase YidC 2

307 amino acids

Required for the insertion and/or proper folding and/or complex formation of integral membrane proteins into the membrane. Involved in integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as at least some lipoproteins.

Belongs to the OXA1/ALB3/YidC family. Type 2 subfamily.

34.53 kDa

MKLTLNRILFSGLALSILFTLTGCVGRDAHGNPKGMIWEFLGKPMSYFIDYFANNAGLGYGLAIIIVTIIVRTLILPLGLYQSWKASYQSEKMTFLKPVFEPINKRIKQASSQEEKMAAQTELMAAQRAHGINPLGGIGCLPLLIQMPFFSAMYFAAQYTKGVSTSTFMGIDLGSRSLVLTAIIAALYFFQSWLSMMAVSEEQREQMKTMMYTMPIMMIFMSFSLPAGVGLYWLVGGFFSIIQQLITTYLLKPRLHKQIKEEYAKTPPKAYQSTSSRKDVTPSQNMEQANLPKKIKSNRNAGKQRKR

yidC2

Membrane protein insertase YidC 2

307 amino acids

Required for the insertion and/or proper folding and/or complex formation of integral membrane proteins into the membrane. Involved in integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as at least some lipoproteins.

Belongs to the OXA1/ALB3/YidC family. Type 2 subfamily.

34.53 kDa

MKLTLNRILFSGLALSILFTLTGCVGRDAHGNPKGMIWEFLGKPMSYFIDYFANNAGLGYGLAIIIVTIIVRTLILPLGLYQSWKASYQSEKMTFLKPVFEPINKRIKQASSQEEKMAAQTELMAAQRAHGINPLGGIGCLPLLIQMPFFSAMYFAAQYTKGVSTSTFMGIDLGSRSLVLTAIIAALYFFQSWLSMMAVSEEQREQMKTMMYTMPIMMIFMSFSLPAGVGLYWLVGGFFSIIQQLITTYLLKPRLHKQIKEEYAKTPPKAYQSTSSRKDVTPSQNMEQANLPKKIKSNRNAGKQRKR

yidC2

Membrane protein insertase YidC 2

307 amino acids

Required for the insertion and/or proper folding and/or complex formation of integral membrane proteins into the membrane. Involved in integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as at least some lipoproteins.

Belongs to the OXA1/ALB3/YidC family. Type 2 subfamily.

34.54 kDa

MKLTLNRILFSGLALSILFTLTGCVGRDAHGNPKGMIWEFLGKPMSYFIDYFANNAGLGYGLAIIIVTIIVRTLILPLGLYQSWKASYQSEKMAFLKPVFEPINKRIKQANSQEEKMAAQTELMAAQRAHGINPLGGIGCLPLLIQMPFFSAMYFAAQYTKGVSTSTFMGIDLGSRSLVLTAIIAALYFFQSWLSMMAVSEEQREQMKTMMYTMPIMMIFMSFSLPAGVGLYWLVGGFFSIIQQLITTYLLKPRLHKQIKEEYAKNPPKAYQSTSSRKDVTPSQNMEQANLPKKIKSNRNAGKQRKR

yidC2

Membrane protein insertase YidC 2

290 amino acids

Required for the insertion and/or proper folding and/or complex formation of integral membrane proteins into the membrane. Involved in integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as at least some lipoproteins.

Belongs to the OXA1/ALB3/YidC family. Type 2 subfamily.

33.671 kDa

MKKKALLPLFLGIMIFLAGCDYSTPEKQDGFFFNTFVQPMKHLLQWLGNDVFHNNFGLAIIVLVLFIRLILLPFMLSNYKNSHMMREKMKVAKPEVDGIQEKVKRARTQEEKMAANQELMEVYKKYDMNPMKSMLGCLPILIQMPIIMGLYFVLKDKLVNGLSEHPHFLWFNLTKPDIWITVIAGVLYFIQAVVSSKTMPQEQRQMGYMMMVISPIMIIWISLQASSALGLYWSVSALFLVIQTHFANIYYSKLAKKEVQPFIEKYEREHNPSSKKKGKNTQVVSKKNKK

yidC2

Membrane protein insertase YidC 2

287 amino acids

Required for the insertion and/or proper folding and/or complex formation of integral membrane proteins into the membrane. Involved in integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as at least some lipoproteins.

Belongs to the OXA1/ALB3/YidC family. Type 2 subfamily.

32.607 kDa

MKKKKRFKQKLLIASLVIGLVAVLSGCGYSTDPITKDSTGFWSHYIVFPLSWVITWFSDLFGGNYAVGIIVVTILIRLLIMPLMIKQLKSQKAMTSLQPKIKELQEKYSSKDNETKQKLQQETMRLYQENSVNPMMGCLPLLIQMPILLGFYQAISRTAEIKTDTFLWMQLGNPDPYYILPIVAALTTFLSSKISMMGQTQQNKSMAMIVYIMPVMILFMGITLPSALALYWIIGNIFTVFQTLLINNPFKNKREQEALAAAQLEEERLKKKAANMKASKKGGKKRK

yidC2

Membrane protein insertase YidC 2

287 amino acids

Required for the insertion and/or proper folding and/or complex formation of integral membrane proteins into the membrane. Involved in integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as at least some lipoproteins.

Belongs to the OXA1/ALB3/YidC family. Type 2 subfamily.

32.5 kDa

MKKKKRFKQKLLIASLVIGLMAVLSGCGYSTDPITSESTGFWSHYIVFPLSWTITWFSDLFGGSYAVGIIVVTILIRLLIMPLMIKQLKSQKAMTNLQPKIKELQEKYSSKDNETKQKLQQETMRLYQENSVNPMMGCLPLLIQMPILLGFYQAISRTAEIKTDSFLWMQLGNPDPYYILPVVAALTTFLSSKISMMGQTQQNKSMAMIVYIMPVMILFMGITLPSALALYWIIGNIFTVFQTLLINNPFKNKREQEALAAAQVAEDRLKKKAANMKASKKGGKKRK

yidC2

Membrane protein insertase YidC 2

280 amino acids

Required for the insertion and/or proper folding and/or complex formation of integral membrane proteins into the membrane. Involved in integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as at least some lipoproteins.

Belongs to the OXA1/ALB3/YidC family. Type 2 subfamily.

32.108 kDa

MNYMKRRLLLFAGILLLVALAGCSTTDPITSESEGIWNHFFVYPMSWLITTVANLLNGSYGLSIIIVTILIRLALLPLTLKQQKSMRAMQVIRPEMEAIQKKYKEKGSKDPKVQQEMQKELLGLYQKHGVNPMAGCLPLFIQLPILMAFYFAIMRTEEIRYHTFLWFDLGQPDYILPFVAGITTYFQFKMTMSHQQQMQKTNPSDSDNPMANMMQMQMKVMLYVMPVMIIIAGLSLPSALSLYWVIGNIFMIIQTYFIVVKAPPLEVEQTKQKSSKPNKA

yidC2

Membrane protein insertase YidC 2

278 amino acids

Required for the insertion and/or proper folding and/or complex formation of integral membrane proteins into the membrane. Involved in integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as at least some lipoproteins.

Belongs to the OXA1/ALB3/YidC family. Type 2 subfamily.

32.335 kDa

MHKRLFITLLGFIILLAGCDYSKEENQTGIFYNVFVKSMDGFLHFLGRVFQDNYGFAIISIVLIVRFILLPFMLIQVKNMHMMREKTKVVQPELDAIRDKMKHATSQEERNAANQLLMKKYQSYGINPLKNMLGCLPVLIQMPILMGLYMSLKYPSSHGITEYPHFLWFDLTQPDLIMTIIAAIMYFVQPLVNSIHYPKDQRKTYYFMMVFSPIFITYASLHSAAALGLYWSISAAFLIVQMHFAHSHYKKVALHEAKKLKQKLEQNKDNSELLTEES

yidC2

Membrane protein insertase YidC 2

277 amino acids

Required for the insertion and/or proper folding and/or complex formation of integral membrane proteins into the membrane. Involved in integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as at least some lipoproteins.

Belongs to the OXA1/ALB3/YidC family. Type 2 subfamily.

31.697 kDa

MKKYRKILAMLAVLAIVLVLSGCSNTPITDKSTGFWDGLIILNFSRAIIWLSNLFGHSYGLGIIVFTLIIRIIILPLMIFQTRNMVAMQEVQPQMKALQKKYSSRDMETQQKLQAEMKKLYAKHGVHPMASMLPLLVQLPILIALYQAIWRTQALKTGSFLWLQLGSKDPYYVLPILAAIFTFASSWLAMKSQPEQNGMTTSMTYLMPVIILITAINVPSALSLYWVISNAFQVGQTLLLQNPFKINREREAKKQAERDRKRTLEKARKRAIRNHKR

yidC2

Membrane protein insertase YidC 2

276 amino acids

Required for the insertion and/or proper folding and/or complex formation of integral membrane proteins into the membrane. Involved in integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as at least some lipoproteins.

Belongs to the OXA1/ALB3/YidC family. Type 2 subfamily.

31.213 kDa

MGVKKKLKLTSLLGLSLLIMTACATNGVTSDITAESADFWSKLVYFFAEIIRFLSFDISIGVGIILFTVLIRTVLLPVFQVQMVASRKMQEAQPRIKALREQYPGRDMESRTKLEQEMRKVFKEMGVRQSDSLWPILIQMPVILALFQALSRVDFLKTGHFLWINLGSVDTTLVLPILAAVFTFLSTWLSNKALSERNGATTAMMYGIPVLIFIFAVYAPGGVALYWTVSNAYQVLQTYFLNNPFKIIAEREAVVQAQKDLENRKRKAKKKAQKTK

yidC2

Membrane protein insertase YidC 2

275 amino acids

Required for the insertion and/or proper folding and/or complex formation of integral membrane proteins into the membrane. Involved in integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as at least some lipoproteins.

Belongs to the OXA1/ALB3/YidC family. Type 2 subfamily.

30.927 kDa

MKKKNIILISVLLGALLLLTGCSMDPSQNTDGFFSTYLIQPFTSFIMFVAKFVGGNYGIAIIITTLLIRALIMPLNLRTAKAQMGMQSKMAVAKPEIDEIQARLKRATSKEEQATIQKEMMAVYSKYNINPMQMGCLPLLIQMPILMAFYYAIRGSSEIASHTFLWFNLGSPDMVLAIIAGLVYLAQYFVSMIGYSPEQKKQMKIIGLMSPIMILFVSFTAPSALALYWAVGGLFLAGQTLLTKKLYMNKHPEIKVMEQEEKEFEQIVEEQKKEK

yidC2

Membrane protein insertase YidC 2

274 amino acids

Required for the insertion and/or proper folding and/or complex formation of integral membrane proteins into the membrane. Involved in integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as at least some lipoproteins.

Belongs to the OXA1/ALB3/YidC family. Type 2 subfamily.

31.057 kDa

MKKKLKLTSLLGLSLLIMTACATNGVTSDITAESADFWSKLVYFFAEIIRFLSFDISIGVGIILFTVLIRTVLLPVFQVQMVASRKMQEAQPRIKALREQYPGRDMESRTKLEQEMRKVFKEMGVRQSDSLWPILIQMPVILALFQALSRVDFLKTGHFLWINLGSVDTTLVLPILAAVFTFLSTWLSNKALSERNGATTAMMYGIPVLIFIFAVYAPGGVALYWTVSNAYQVLQTYFLNNPFKIIAEREAVVQAQKDLENRKRKAKKKAQKTK

yidC2

Membrane protein insertase YidC 2

258 amino acids

Required for the insertion and/or proper folding and/or complex formation of integral membrane proteins into the membrane. Involved in integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as at least some lipoproteins.

Belongs to the OXA1/ALB3/YidC family. Type 2 subfamily.

28.725 kDa

MKKKLGLLAMVVALMAIATGCSETGQPITSKSTGIWNEYFVYPLSQLITYFADLFNSNYGLAIVITTLIIRFALLPLMIKQTKSTKAMQALQPEMVKLKEKYSSKDQATQQKLQQEMMQLYQKNGVNPLAGCLPIFVQMPILFAFYHAIMRTAEIKQHSFLWFDLGHADPFYILPVVAAITTFIQQKLAMAGTAGQNPQMAMMLWLMPIMILIFAINFPAALSLYWVVGNIFGIAQMYFIKGPEIKASKAGKAGGSSK

yidC2

Membrane protein insertase YidC 2

255 amino acids

Required for the insertion and/or proper folding and/or complex formation of integral membrane proteins into the membrane. Involved in integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as at least some lipoproteins.

Belongs to the OXA1/ALB3/YidC family. Type 2 subfamily.

28.424 kDa

MKKKLGLLAMVVALMAITAGCSEVNQPITPKSTGIWNEYFVYPLSQLITYFANLFGSNYGLAIVVTTLIIRFALLPLMIKQTKSTKAMQALQPEMVKLKEKYSSKDQATQQKLQQEMMQLYQKNGVNPLAGCLPIFVQMPILFAFYHAIMRTSEISKHTFLWFDLGQADPYYILPVVAAITTFIQQKLAMAGTAGQNPQMAMMLWLMPIMILIFAINFPAALSLYWVVGNIFGIAQMYLIKGPEIKASKAGGSSK