About Products Protein Database Contact

Protein expression services for yidC2 | Membrane protein insertase YidC 2

Description
Required for the insertion and/or proper folding and/or complex formation of integral membrane proteins into the membrane. Involved in integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as at least some lipoproteins (By similarity). Partially complements an E.coli yidC depletion experiment.
Family
Belongs to the OXA1/ALB3/YidC family. Type 2 subfamily.
Species
Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Length
310 amino acids
Sequence
MKKIYKRLLFSGLALSMLFFLSGCVQMKNGKPTGEGWVYKFFAAPMGSVIQYLANNLGLGFGFAIIIVTVIVRLLILPLGLSQVRKMTYQSEKMAYLKPVFDPIQERMKNAKTQEEKMAAQTELMQAQRHYGMSMFGGLGCLPLLIQMPFFSALYISTRYTKGIASASFLGIKLGSPNMIITVIIGILYLVQSWVSTLSVPEAQRQQTRNMMFMMPIMMVMISIGAPAGGALYWLVSGIFGLIQQLITNHIIKPKLRKQIDEEFKKNPPKPFKSNARKDITPQANNDKKLITSKKQKSNRNAGKQRHHKQ
Mass
34.9 kDa
Simulated SDS-PAGE
Western blot of yidC2 recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make yidC2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here