About Products Protein Database Contact

Protein expression services for yidC2 | Membrane protein insertase YidC 2

Description
Required for the insertion and/or proper folding and/or complex formation of integral membrane proteins into the membrane. Involved in integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as at least some lipoproteins.
Family
Belongs to the OXA1/ALB3/YidC family. Type 2 subfamily.
Species
Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711)
Length
258 amino acids
Sequence
MKKKLGLLAMVVALMAIATGCSETGQPITSKSTGIWNEYFVYPLSQLITYFADLFNSNYGLAIVITTLIIRFALLPLMIKQTKSTKAMQALQPEMVKLKEKYSSKDQATQQKLQQEMMQLYQKNGVNPLAGCLPIFVQMPILFAFYHAIMRTAEIKQHSFLWFDLGHADPFYILPVVAAITTFIQQKLAMAGTAGQNPQMAMMLWLMPIMILIFAINFPAALSLYWVVGNIFGIAQMYFIKGPEIKASKAGKAGGSSK
Mass
28.7 kDa
Simulated SDS-PAGE
Western blot of yidC2 recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make yidC2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here