wnt1

Protein Wnt-1

371 amino acids

Ligand for members of the frizzled family of seven transmembrane receptors (Probable). Acts in the canonical Wnt signaling pathway by promoting beta-catenin-dependent transcriptional activation (By similarity). Plays an important role in patterning during embryonic development (PubMed:2673541). Plays an essential role in the development of the embryonic brain and central nervous system (CNS) (By similarity). Has a role in osteoblast function, bone development and bone homeostasis (By similarity).

Belongs to the Wnt family.

41.126 kDa

MRILTFLLGLKTLWVLAFSSLSNTIAVNNSGKWWGIVNVASAGNVLPGSDARPVPLVLDPSLQLLSRQKRLIRQNPGILQSITRGLHSAIRECKWHFRNRRWNCPTGTGNQVFGKIINRGCRETAFVFAITSAGVTHSVARSCSEGSIESCSCDYRRRGPGGPDWHWGGCSDNIEFGRFIGREFVDSSERGRDLKYLVNLHNNQAGRLTVLTEMRQECKCHGMSGSCSLRTCWMRLPPFRSVGDALKDRFDGASKVTYSNNGSNRWGSRSDPPHLEPENPTHALPSSQDLVYFEKSPNFCSPSEKNGTPGTTGRICNSTSLGLDGCELLCCGRGYRSLAEKVTERCHCTFNWCCHVTCLNCTSSQIVHECL

wnt1

Protein Wnt-1

370 amino acids

Ligand for members of the frizzled family of seven transmembrane receptors. Acts in the canonical Wnt signaling pathway by promoting beta-catenin-dependent transcriptional activation (By similarity). Involved in neurogenesis. Performs a partially redundant function with wnt10b in the formation of the midbrain-hindbrain boundary (MHB) organizer. In the hindbrain, mediates lateral inhibition of boundary cell specification, probably via up-regulation of proneural and Delta gene expression in non-boundary cells; localized expression of wnt1 in boundary cells is maintained via rfng-mediated modulation of Notch activity.

Belongs to the Wnt family.

41.011 kDa

MRVLALLLAVKAACVLLVSSLTGTGAVNNSGRWWGIVNVASSGNLLTNSKNVQLVLDPSLALLSRRQRKLIRQNPGILHAIAAGLHTAIKECKWQFRNRRWNCPTTHSPNVFGKIVNRGCRETAFVFAITSAGVTHAVARSCSEGAIESCTCDYRRRGPGGPDWHWGGCSDNVEFGRMFGREFVDSSERGRDLRYLTNLHNNEAGRMTVASEMQQECKCHGMSGSCTVRTCWMRLPSFRLVGDYLKDRFDGASRVVYANKGSNRASHRADPRHLEPENPAHKLPSSRDLVYFEKSPNFCSYNGKTGTHGTSGRTCNSSSPALDGCELLCCGRGYKTRMEQVTERCHCTFHWCCHVSCLNCTSTQTVHQCL

WNT1

Proto-oncogene Wnt-1

370 amino acids

Ligand for members of the frizzled family of seven transmembrane receptors (Probable). Acts in the canonical Wnt signaling pathway by promoting beta-catenin-dependent transcriptional activation (PubMed:23499309, PubMed:26902720, PubMed:28528193, PubMed:23656646). In some developmental processes, is also a ligand for the coreceptor RYK, thus triggering Wnt signaling (By similarity). Plays an essential role in the development of the embryonic brain and central nervous system (CNS) (By similarity). Has a role in osteoblast function, bone development and bone homeostasis (PubMed:23499309, PubMed:23656646).

Belongs to the Wnt family.

40.982 kDa

MGLWALLPGWVSATLLLALAALPAALAANSSGRWWGIVNVASSTNLLTDSKSLQLVLEPSLQLLSRKQRRLIRQNPGILHSVSGGLQSAVRECKWQFRNRRWNCPTAPGPHLFGKIVNRGCRETAFIFAITSAGVTHSVARSCSEGSIESCTCDYRRRGPGGPDWHWGGCSDNIDFGRLFGREFVDSGEKGRDLRFLMNLHNNEAGRTTVFSEMRQECKCHGMSGSCTVRTCWMRLPTLRAVGDVLRDRFDGASRVLYGNRGSNRASRAELLRLEPEDPAHKPPSPHDLVYFEKSPNFCTYSGRLGTAGTAGRACNSSSPALDGCELLCCGRGHRTRTQRVTERCNCTFHWCCHVSCRNCTHTRVLHECL

Wnt1

Proto-oncogene Wnt-1

370 amino acids

Ligand for members of the frizzled family of seven transmembrane receptors. Acts in the canonical Wnt signaling pathway by promoting beta-catenin-dependent transcriptional activation (By similarity). In some developmental processes, is also a ligand for the coreceptor RYK, thus triggering Wnt signaling (PubMed:15454084, PubMed:16116452). Plays an essential role in the development of the embryonic brain and central nervous system (CNS) (PubMed:2202907, PubMed:16116452). Has a role in osteoblast function, bone development and bone homeostasis (By similarity).

Belongs to the Wnt family.

41.086 kDa

MGLWALLPSWVSTTLLLALTALPAALAANSSGRWWGIVNIASSTNLLTDSKSLQLVLEPSLQLLSRKQRRLIRQNPGILHSVSGGLQSAVRECKWQFRNRRWNCPTAPGPHLFGKIVNRGCRETAFIFAITSAGVTHSVARSCSEGSIESCTCDYRRRGPGGPDWHWGGCSDNIDFGRLFGREFVDSGEKGRDLRFLMNLHNNEAGRTTVFSEMRQECKCHGMSGSCTVRTCWMRLPTLRAVGDVLRDRFDGASRVLYGNRGSNRASRAELLRLEPEDPAHKPPSPHDLVYFEKSPNFCTYSGRLGTAGTAGRACNSSSPALDGCELLCCGRGHRTRTQRVTERCNCTFHWCCHVSCRNCTHTRVLHECL

WNT1

Protein Wnt-1

368 amino acids

Ligand for members of the frizzled family of seven transmembrane receptors (Probable). Acts in the canonical Wnt signaling pathway by promoting beta-catenin-dependent transcriptional activation (PubMed:25451226). Developmental protein that promotes cell proliferation in the developing spinal cord (PubMed:25451226). Has a role in osteoblast function, bone development and bone homeostasis (By similarity).

Belongs to the Wnt family.

40.797 kDa

MRGPALLLALRALCALSALRGTARAVNNSGRWWGIINVASSTNLLTDSGSVQLVLEPGLQLLSRKQRRLIRQNPGILHSVSAGLQSAVRECQWQFRNRRWNCPTSQGPNIFGKIVNRGCRETAFIFAITSAGVTHSVARSCSEGSIESCTCDYRRRGPGGPDWHWGGCSDNIDFGRLFGREFVDSSEKGRDLRFLMNLHNNEAGRMTVFSEMRQECKCHGMSGSCTVRTCWMRLPTFRAVGDVLKDRFDGASRVIYGNKGSNRASRVELHHLEPENPAHKPPSPHDLVYFEKSPNFCTYSGKMGTAGTAGRACNSSSPGLDGCELLCCGRGFRTRTQRVTERCNCTFHWCCHVSCLNCTNTQVLHECL