Ligand for members of the frizzled family of seven transmembrane receptors (Probable). Acts in the canonical Wnt signaling pathway by promoting beta-catenin-dependent transcriptional activation (By similarity). Plays an important role in patterning during embryonic development (PubMed:2673541). Plays an essential role in the development of the embryonic brain and central nervous system (CNS) (By similarity). Has a role in osteoblast function, bone development and bone homeostasis (By similarity).

Belongs to the Wnt family.

371 amino acids

MRILTFLLGLKTLWVLAFSSLSNTIAVNNSGKWWGIVNVASAGNVLPGSDARPVPLVLDPSLQLLSRQKRLIRQNPGILQSITRGLHSAIRECKWHFRNRRWNCPTGTGNQVFGKIINRGCRETAFVFAITSAGVTHSVARSCSEGSIESCSCDYRRRGPGGPDWHWGGCSDNIEFGRFIGREFVDSSERGRDLKYLVNLHNNQAGRLTVLTEMRQECKCHGMSGSCSLRTCWMRLPPFRSVGDALKDRFDGASKVTYSNNGSNRWGSRSDPPHLEPENPTHALPSSQDLVYFEKSPNFCSPSEKNGTPGTTGRICNSTSLGLDGCELLCCGRGYRSLAEKVTERCHCTFNWCCHVTCLNCTSSQIVHECL

41.1 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make wnt1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here