Tgt

Queuine tRNA-ribosyltransferase catalytic subunit

427 amino acids

Catalytic subunit of the queuine tRNA-ribosyltransferase (TGT) that catalyzes the base-exchange of a guanine (G) residue with queuine (Q) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming queuine, allowing a nucleophilic attack on the C1' of the ribose to form the product.

Belongs to the queuine tRNA-ribosyltransferase family.

47.751 kDa

MGPSHIPPLTYKVVAECSVSKARAGLMTLRHSEVNTPVFMPVGTQGTLKGIVPDQLIELNCQILLGNTYHLGLRPGIETLKKAGGLHKFMGWPRAILTDSGGFQMVSLLQLAEIDEHGVNFRSPFDNSQCMLTPEHSIEIQNAIGGDIMMQLDDVVKTTTTGPRVEEAMERTIRWVDRCIEAHARDDDQSLFPIVQGGLDVPLRQRCVSALMERQVRGFAVGGLSGGESKHDFWRMVDVCTGYLPKDKPRYLMGVGFAADLVVCVALGIDMFDCVFPTRTARFGCALVDSGQLNLKQPKYKLDMEPIDKDCDCSTCRRYTRSYLHHIATNESVSSSLLSIHNVAYQLRLMRSMREAIQRDEFPQFVADFMARHFKAEPVPAWIREALSAVNIQLPADPERIDEQDQKPKTEKRRETEDVAEEQVASS

tgt

Putative queuine tRNA-ribosyltransferase

403 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

46.396 kDa

MPLKFRIKHTLDRMRVGKVKTRHGSFETPVFIPVATLAAIRGLDNRDLKDMGVEVILANTYHLHLRPGDELIKELGGLHKFMNFDGVIVTDSGGFQAFSLGFGMEHGVGKIANNIFLEELREERLREAENERKKLAVVTDRGVRFKDPKSGRIVELTPKKSMEIQSNLGSDIIFAFDECTSPLSDRDYTEKALERTHRWAEECLQHYDRRQALFGVVQGGEYRDLREKSARFMAERDFAGYGIGGSLGKSKQDMLNILDWVIPLLPEEKPRHLLGIGAIEDLFNCTEKGVDMYDCVAPARWARRGHLYVSPAEGGNVRNKFRIHIKNAAFRIDNRPVDRTCDCLVCQNYSRAYLRHLYKANELLYFRLATYHNIYFVVKLMERIRESIADGSFYELKREWLGF

tgt

Queuine tRNA-ribosyltransferase

400 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

44.975 kDa

MTLAFDIEARDPHSRARAGRITTAHGVIETPVFMPVGTRGSIKSLTPDEVRNHGAQIILGNTYHLYLQPGHELIARMGGLHHFMGWDGPILTDSGGFQVFSLVYGGIADEIKGRRPTQQVQPGMVKVTDDAVIFKSYIDGSMHVFTPERSIEIQKGIGADIILCFDELPPFHAGYDYTARSLERTHAWERRCLMFHRATQEGGLPFVPPNPYQALFGIVHGGVFPDLRRASAEYLRELPFDGLCIGGSLGENKQQMREVVDMTVPHMPDHLPRHLLGIGDVDDLIECVARGIDMFDCVSPTRLGRHGTALVRDAERRWKLNVANAALRDDPTPLDAWCDCYTCRRYSRAYIHHLFRAQELLGIRLVSLHNVAFLLKLMRTIRQSIIEGRFAHLRAEWLGI

tgt

Queuine tRNA-ribosyltransferase

400 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

44.73 kDa

MAVRWELLRRDPASAARLGRLHTPRGVIETPVFMPVGTQATVKTLNPEEVWDLGARIILSNTYHLYLRPGHDLVQEAGGLHRFMNWKGAVLTDSGGFQVFSLADLRKITEEGVQFRSHIDGSTHFLSPEKAIAVENALGADIIMAFDECTPWPCDYDYAKRSIERTARWAARCKAAHARPDEQALFGIVQGSTFADLRRQSAEEIVALDFPGYGIGGLSVGEPKELMHEMLEVQVPLLPDDRPRYLMGVGSPEDLVEGVWRGVDMFDCVLPTRIARHGTVFVPDGKMTVRNAEFARDFLPIQEGCDCYACRNFSRAYIRHLLKADEMLGLRLCSIHNLRFLVRLMEEIRAALAAGTFAEYRKAFLERWHAGEAERRERARAAGGAGHAPGPAEPLLPENR

tgt

Queuine tRNA-ribosyltransferase

398 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

44.333 kDa

MLEFEVLKTDARTGEGANAHPGSHARRGQLTLTHGVVQTPIFMPVGTYGTVKGVMPQSLHEMGAQIILGNTFHLWMRPGLDVMKQFGGLHRFESWDKPILTDSGGFQVWSLGDMRKISEEGVKFASPVNGDKLFLTPEISMQIQTVLNSDIVMQFDECTPYDTKGHITTESEARSSMELSLRWAKRCVAEFDKLENPNALFGIVQGGMYQNLRHESLEALVELDLPGYAVGGVSVGEPKEEMQRIMAHTPHRLPADKPRYLMGVGTPEDLVEGVGAGIDMFDCVMPTRNARNGHLFTRFGDLKIRNARHKADEQPLDTTCTCYTCKGRTMPDGSTSGGFSRAYLHHLDRCGEMLGPMLASIHNLHYYLNLMQEIRDALDAGRFGEFAARFRTDRLRGV

tgt

Queuine tRNA-ribosyltransferase

394 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

42.171 kDa

MSRTPGFSFSELARDGHARTGVLSTPHGDVLTPTFMPVGTQGSVKTLTPAEVAATGARIVLGNTYHLWLRPGPELVAQLGGLHAFTRWPHAMLTDSGGFQAFSLAERRTLVEDGFVFRSHLDGARKALTPEVAMEVQGLLGADIAMQLDVCPPGGAPRPEVEEACRLTTRWGKRCLAAKRPSQALFGIVQGGTSVALRMAHADELGALPFDGLALGGFSVGEPIAMMHEVVAQIGPHLDPTRPRYLMGVGTPIDLVHAIGAGVDMFDCVLPTRNARNGQALTQHGKIVIKQARYKEDRSPLDPTCACPTCTGGYSRAYLRHLYMAGEILVLRLLTEHNLHLYGRLMREARAAIAEGRYAAFARAWLGASDAGNANDANETVGATESTESTESTE

tgt

Queuine tRNA-ribosyltransferase

394 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.851 kDa

MNQCGTITAVFEFEIKQRDGRARTATFQTPRGAVTTPMFMPVGTQGTVKGISPQELLEIGSQMILANTYHLMLRPGEQLVKAHGGLPGFTAYPGPFLTDSGGFQVMSLGHMRKISEEGVVFKNHLDGSRVELTPERSIQVQEALGADVIMAFDECPPYPAERPYIEASLDRTVRWLERCHAVKTKDDQALFAIVQGGVHEDLRLKSLEATLPFATPGFAVGGLAVGESKEEMYPAVAFTAGRLPENKPRYLMGVGHPEDLVAGVALGIDMFDCVYPTRTGRFGYALTDDGRLNLNSSAPRTQLQPIDAECDCYACRHYTRAYLAHLLRAEEMLAPRMLSLHNLRYLHRLVERMRVAINGQQFHPWAADWSERYFHGNVPGWFTSAFERSTQSEI

tgt

Queuine tRNA-ribosyltransferase

392 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.59 kDa

MNNFTYTLEHSDGEARAGQFSTPHGTIQTPVFMPVGTQATVKTLDPLEVEAIGSQIILSNTYHLYLRPSADLVAEMGGLHRFMQWPKPILTDSGGFQVFSLGPHSKIDEDGVTFKSHIDGSKHRFTPESAIGIQEKLGADIIMAFDECAPQPTTHAYTKAAMERTHRWLLRCIAAKTRADQALFGIVQGGVEADLRRESASFIAQQDVPGIGIGGLSVGEPKEQMYGMLEETTPLLPRNKPRYLMGVGSPEDLLEGVARGVDMFDCVLPTRLGRNGALFIPEGRLNIGNAKYAREDAPIDATCDCSTCQRFSRAYLRHLFRTEEVLGLRLATLHNLRFLIRLMEQAREAILQDRYQSFMDDWLSRFQTIPHAVREASRAARLNSLRTQGDKA

tgt

Queuine tRNA-ribosyltransferase

392 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.75 kDa

MDKSFILNKTSPRSSARRGQLLTAHGQVETPVFCPVGSQATVKTLTPEDLKSVNVNMILSNTYHLYLRPGIPVVKEMGGLHKFMNWDGVILTDSGGYQIFSLANLRKLDEGGVSFRSHIDGSTRYITPEDAVSFQQDLGSDIAMVLDECPHSEASENEVLAAMERTHQWAKRCLAAHTLKSQHLFAIVQGGLSPVLRQQSAEYLASLDFPGYALGGLSLGEPKDITFETVRHTLRFLPENKPRYLMGVGAPEDLLEGVSCGVDIFDCVLPTRVARNGAFFSRLGRLNIRNASFATQKGPVDPECNCYTCRNYSAAYLHHLFRCEEILAYRLATIHNIAFLSNLMQEVRTSIEKDCFEEFKGDFLTRYQPTNESVRIEQKQKWLSARSGETSS

tgt

Queuine tRNA-ribosyltransferase

392 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.975 kDa

MDKSFILNKTSSRSLARRGQLFTAHGKVETPVFCPVGSQATVKTLTPEDLKSVNINMILSNTYHLYLRPGIPIIKEMGGLHKFMNWDGVILTDSGGYQIFSLANLRKLDEGGVSFRSHIDGSTRYITPEDAVSFQQDLGSDIAMVLDECPHSEASENEVLAAMERTHQWAKRCLAAHTLKSQHLFAIVQGGLSPELRRQSAEYLASLDFPGYALGGLSLGEPKDITFETVRHTLRFLPENKPRYLMGVGAPEDLLEGVSCGVDIFDCVLPTRVARNGAFFSRLGRLNIRNAAFATQKGPIDPDCNCYTCRNYSAAYLHHLFRCEEILAYRLATIHNIAFLSNLMQEIRTSIEKDCFEEFKADFLSRYQPTNEAIRIEQKQKWLFGRNGEPPS

tgt

Queuine tRNA-ribosyltransferase

392 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

44.057 kDa

MDKSFILNKTSSRSLARRGQLFTAHGKVETPVFCPVGSQAAVKTLTPEDLKSVNINMILSNTYHLYLRPGIPIIKEMGGLHKFMNWDEVILTDSGGYQIFSLANLRKLDEGGVSFRSHIDGSTRYITPEDAVSFQQDLGSDIAMVLDECPHSEASENEVLAAMERTHQWAKRCLAAHTLKIQHLFAIVQGGLSPELRRQSAEYLASLDFPGYALGGLSLGEPKDITFETVRHTLRFLPENKPRYLMGVGAPEDLLEGVSCGVDIFDCVLPTRVARNGAFFSRLGRLNIRNAAFATQKGPIDPECNCYTCRNYSAAYLHHLFRCEEILAYRLATIHNIAFLSNLMQEIRTSIEKDCFEEFKADFLSRYQPTNEAIRIEQKQKWLFGRNGEPPS

tgt

Queuine tRNA-ribosyltransferase

390 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.493 kDa

MLKFEILATDTSSHARRGTLTLNHGVVQTPIFMPVGTYGTVKGVMPRSLREMGAQIILGNTFHLWMRPGLDVMQSFGGLHGFEQWDKPILTDSGGFQVWSLGSMRKITEEGVHFASPVNGDKLFMSPEVSMQIQTTLNSDIVMQLDECTPYETNGHKTTEAEARKSMEMSRRWAVRSKNEFERLGNPNALFGIVQGGMYKNLRQESLEALVEMDFPGYAVGGVSVGEPKDEMLDIMAHTPHRLPAHKPRYLMGVGTPEDLVEGVAQGVDMFDCVMPTRNARNGTLFTRYGDLKIRNARHKTDHQPLDPSCTCHACAGTEGVSWNDGGRGGFSRAYLHHLDRCGEMLGPMLTTIHNLHYYLNLMREVREALDAGQFGAFRARFKAERARGV

tgt

Queuine tRNA-ribosyltransferase

390 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.52 kDa

MLKFEILATDTSSHARRGKLTLNHGVVQTPIFMPVGTYGTVKGVMPRSLREMGAQIILGNTFHLWMRPGLDVMQSFGGLHGFEQWDKPILTDSGGFQVWSLGSMRKITEEGVHFASPVNGDKLFMSPEVSMQIQTTLNSDIVMQLDECTPYETNGHKTTEAEARKSMEMSRRWAVRSKNEFERLGNPNALFGIVQGGMYKNLRQESLEALVEMDFPGYAVGGVSVGEPKDEMLDIMAHTPHRLPAHKPRYLMGVGTPEDLVEGVAQGVDMFDCVMPTRNARNGTLFTRYGDLKIRNARHKTDHQPLDPSCTCHACAGTEGVSWNDGGRGGFSRAYLHHLDRCGEMLGPMLTTIHNLHYYLNLMREVREALDAGQFGAFRARFKAERARGV

tgt

Queuine tRNA-ribosyltransferase

390 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.235 kDa

MLQFDLLTTDPASHARRGRLTLRHGQVQTPIFMPVGTHGSVKGVLPRSLHEMGAQIILGNTFHLWLRPGLAVLQGFGGLHGFEKWNKPILTDSGGFQVWSLGALRTITEEGVHFASPVNGDKLFLSPEVSMQIQTTLDSDIVMQLDECTPYETRGQRTTERAACQSMQMSLRWAKRSQDEFQRLNNPNALFGIVQGGMYENLRAESLAALAAMDLPGYAIGGVSVGEPKDEMLRIMAHTPHRLPAHKPRYLMGVGTPEDLVEGVAQGVDMFDCVMPTRNARNGTLFTRFGDLKIRNARHKTDPQPLDGSCTCYTCAGPSGVAWDQGGRDGFSRAYLHHLERCGEMLGPMLSTVHNLHYYLNLMREIRQALDAGEFTQLRARLKADRARGV

tgt

Queuine tRNA-ribosyltransferase

390 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.545 kDa

MLQFDLLKTDPSSHARRGQLTLNHGVVQTPIFMPVGTYGTVKGVMPRSLQEMGAQIILGNTFHLWMRPGLDIMQSFGGLHGFEKWDKPILTDSGGFQVWSLGAMRKITEEGVHFASPVNGDKLFMSPEVSMQIQTVLNSDIVMQLDECTPYETNGHKTTEAEARKSMEMSRRWAKRSSDEFQRLGNPNALFGIVQGGMYENLREESLQALVEMDFPGYAVGGVSVGEPKDEMLAIMAHTPHRLPAHKPRYLMGVGTPEDLVQGVADGVDMFDCVMPTRNARNGTIFTRYGDLKIRNARHKTDHQPLDPSCTCHACAGTSGVSWEQGGRDGFSRAYLHHLDRCGEMLGPMLTTIHNLHYYLNLMQEVRNALEAGNFTEMRARFKAERARGV

tgt

Queuine tRNA-ribosyltransferase

390 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.485 kDa

MLQFELLATDPASHARRGTLTLNHGVVQTPIFMPVGTYGTVKGVMPRSLHEMGAQIILSNTFHLWMRPGLDVMQSFGGLHGFEQWNKPILTDSGGFQVWSLGAMRKITEEGVHFASPVNGDKLFMSPEVSMQIQTVLNSDIVMQLDECTPYETKGHKTTEAEARKSMEMSLRWARRSQDEFHRLGNPNALFGIVQGGMYKNLRQESLERLVEMDFPGYAVGGVSVGEPKDEMLDIMAHTPHRLPAHKPRYLMGVGTPEDLVQGVADGVDMFDCVMPTRNARNGTIFTRFGDLKIRNARHKADHQPLDPTCTCHACAGTEGVAWADGGRGGFSRAYLHHLDRCGEMLGPMLTTVHNLHYYLNLMREIRESLDAGRFGEFRARFAADRAQGV

tgt

Queuine tRNA-ribosyltransferase

390 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.549 kDa

MLNFDLLTTEGHARRGRLTLNHGVVETPIFMPVGTYGTVKGVMPRDLETMGAQIILGNTFHLWMRPGQDVMAQFGGLHRFENWTRPILTDSGGFQVWSLGEMRKISEEGVRFASPVNGDKLFLTPEVSMQIQTVLNSDIVMQFDECTPYWQGAKNVGHITTEKEARVSMELSLRWAARSKAEFARLGNPNALFGIVQGGMFESLREESLNALVELDFPGYAVGGVSVGEPKDEMLRIMNHTPHLLPADKPRYLMGVGTPEDLVDGVACGVDMFDCVMPTRNARNGHLFTRYGDLKIRNARHKADERPLDETCSCQACKGSTLPDGRVTGGFSRAYLHHLDRCGEMLGPMLASIHNLHYYLNLMREVREALDAGRFEAFRAQFKADRARGV

tgt

Queuine tRNA-ribosyltransferase

388 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

45.186 kDa

MSFEVIQRDKNTRARLGRLKTFHGEVNTPVFMPVGTQGAVKTLSPEEVEEVGAEIILSNTYHLFLRPGQEIIKKGGGLHRFIGWDKPILTDSGGYQVFSLARLRKIEEDGIYFNSHIDGSQYFFTPELVMEVQKALGSDIIMPLDICLGYGASYWETKEALEITLRWLKRSIDYKKNNNMETQLLFGIIQGGFYRELRKEAVERMLDMELPGFALGGISVGEPKDKMYEITDYTVSLLPEEKPRYLMGVGAPEDLVMGVSMGIDMFDCVLPTRLARHGVFYTKTGRRNIKNAQYKEDFSPLEEDCDCYTCRRFTKAYIRHLFLQHETFSYRLLTIHNLRFLFRLMEDVRRSIREGRLEEFKKEFLTQYLANDRENRLEKEEVWNRLLI

tgt

Queuine tRNA-ribosyltransferase

388 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

45.138 kDa

MIFEIIVRDKKTRARLGKLKTFHGEINTPVFMPVGTQGAVKTLSPEEVEKVGAEIILSNTYHLFLRPGHEIVRKGGGLHKFMGWEKPILTDSGGYQVFSLARLRRIDEDGIYFNSHIDGTRYFYTPELVMEIQKSLGSDIIMPLDICLGYGASYWETKEALEITLRWLKRSIDYKNNSNMDHQLLFGIVQGGFYKELRKEAVERMLNIDLPGLALGGISVGEPKDKMYEIIDYTVSLLPEEKPRYLMGVGAPEDLVVGVSMGIDMFDCVLPTRLARHGVFYTSKGRKNIKNAQYKEDFSPLEEDCDCYTCRKFTKAYIRHLFLQHETFSYRLLTIHNLRFLFRLMENIRKSIREGRLEEFKKEFLTEYLRDDRENRLEKEELWSKLLI

tgt

Queuine tRNA-ribosyltransferase

388 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.682 kDa

MKFEVLKTDGNARAGVLTTAHSVIQTPIFMPVGTVGAVKSLDATDMREILDAKIILANTYHMYLRPGSRVVAEFGGLHGFCKFNRSFLTDSGGFQAFSLRANTKNDEGGIKFKSHIDGSIHYFTPRSVLDTQYELDSDIMMILDDLVELPRDPHALGADEKARLKKRIDLSVTRTIKWAREAIDYHKFKQSQGAGLDQNIFGIIQGGTDYDARKICAQALCEMPFDGLAIGGLSVGEANEHMYETVEAVMPFIDAARPRYLMGVGTPEDIVENVQRGVDMFDCVMPTRNARNGTLFTSFGKIAIKNARFVNDHEPIDPECECYTCRRYSRGYLNHLFRAHELTFFRLASLHNLHYYLNLMKQIREAITAGKFSEFKREFYAKRSGGEI

tgt

Queuine tRNA-ribosyltransferase

387 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.405 kDa

MFYSFCKVGQYMTYFKFELIHRSKKSRARVGRIHTPHGIIDTPNFVAVGTNGTVKALNNTMLHDIGLQLMFCNTYHMMLQPGTDIVRQAGGLHSFIQRKLPIITDSGGFQVFSLAYGSVADELKSRGTKKQGGCVLKITEEGVLFRSYRDGSKVLLTPESSIKAQKDLGADIIIPFDELPPYHIARDALKKSLDRTHRWEKRSLEAHLKNPQEQAMYAVVHGGIDPDLRKESCAILTELPFDGFAVGGSMGKTKDEMHTLLSLTLPLLPEDKPNHLLGIGDLPSIERSVPLGIDTFDSSYPTRAARHGILLTKQGPLNITKSEYATNFNSIEKGCLCPACHHFSLAYIHHLFKARELTCMSLATVHNLYFMVQLMEKYRKQIQEDLI

tgt

Queuine tRNA-ribosyltransferase

387 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.469 kDa

MLEFEVLKTDPATVDSEGAYLGSYARRGQLTLNHGVVQTPIFMPVGTYGTVKGVTPQSLHDMNAQIILGNTFHLWMRPGLDVVAQFGGLHKFESWHKPILTDSGGFQVWSLGEMRKISEEGVKFASPVNGDKLFLTPEISMQIQTLLNSDIVMQFDECTPYDTKGHITTEGEARSSMELSRRWAKRCEIEFDKLENPNALFGIVQGGMFENLRQESLDALVEMDFPGYAVGGVSVGEPKEEMLRIMAHTPHRLPAHKPRYLMGVGTPEDLVEGVASGVDMFDCVMPTRNARNGHMFTRFGDLKIRNARYKSEEAPVDSTCGCYTCRNFSRAYMHHLDRCGEMLGPMLSSIHNLHYYLNLMQEVRGALDAGRFGEFVRQFKADRQRGV

tgt

Queuine tRNA-ribosyltransferase

387 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

42.198 kDa

MSTAFRWVEQARVGRARAGHLHTAHGVVPTPTFMPVGTVGTVKAMTMDSVRSTGAGIVLGNTYHLMLRPGAEKVRALGGLHRFMDWPGPILTDSGGFQVMSLGALRKLDQDGVTFNSHIDGSKHRLTPERSTDIQHALDATITMCFDECPALPAPPETIAQSMRLSMRWAARCREAFVPRAGYAQYGIIQGGTEPELRAESVRALTGIGFEGYAIGGLAVGEGQELMYATLDATVPLIPHDSPRYLMGVGTPDDLLGAVERGVDMFDCVMPTRAGRTARAYTERGTLNLRNARHADDTRPLSPHCDCLACTRHSRAYLHHLFRANEILGPMLLTWHNLAYYQRLMRGMRGAIVAGTLGAHAAGLRAEWAMEDWTPDEMPPPDLPPVP

tgt

Queuine tRNA-ribosyltransferase

386 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

42.843 kDa

MVEATAQETDRPRFSFSIAAREGKARTGTIEMKRGVIRTPAFMPVGTAATVKALKPETVRATGADIILGNTYHLMLRPGAERIAKLGGLHSFMGWDRPILTDSGGYQVMSLSSLTKQSEEGVTFKSHLDGSRHMLSPERSIEIQHLLGSDIVMAFDECTPYPATPSRAASSMERSMRWAKRSRDAFDSRKEQAENAALFGIQQGSVFENLRQQSADALAEIGFDGYAVGGLAVGEGQDEMFRVLDFSVPMLPDDKPHYLMGVGKPDDIVGAVERGIDMFDCVLPTRSGRNGQAFTWDGPINIRNARFSEDLTPLDSECHCAVCQKWSRAYIHHLIRAGEILGAMLMTEHNIAFYQQLMQKIRDSISEGRFSQFAQDFRARYFARNS

tgt

Queuine tRNA-ribosyltransferase

386 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.951 kDa

MFFRLDLESCMKFEKLGQSGRARRGRLTLAHGVVETPVFMPVGTYGTVKGMLPRDIEEIQAQIILGNTFHLYLRPGLEVIKEHGGLHEFIKWDKPILTDSGGFQVFSLGAMRKIKEEGVTFRSPIDGSKVFLSPEISMEIQQVLNSDIVMIFDECTPYPATHEEAQKSLQLSLRWAKRCKTHHHEQLNNTNALFGIIQGGMYEDLRDESLNGLLEIGFDGYAIGGLSVGEPKEEMIKVLDYLPAKMPEDKPRYLMGVGKPEDIVEAVRRGVDMFDCVMPTRNARNGHYFVTDGLVRIRNSKYRHDQSPLDPHCDCYTCKNFTRAYLYHLEKCGEMLASMLGTIHNLRYYQRLTQGIRDALEQGTFDEFVTDFYTRRGLDVPPAPVD

tgt

Queuine tRNA-ribosyltransferase

385 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

44.013 kDa

MKYELDKTDGNARRGRLVFERPQGTFTVETPAFMPVGTYGTVKGMTPEEVRATGAEILLGNTFHLWLRPGQEVMRKHGDLHDFMQWHRPILTDSGGFQVFSLGKLRKITEEGVKFQNPINGERIFLSPEKSMEIQYDLGSDIVMIFDECTPYPATFDYAKKSMEMSLRWAKRSRDRFDELGNKNALFGIIQGGVYEELRKVSVEGLVNIGFDGYAVGGLAVGEPKEDMHRILEYVCPQIPADKPRYLMGVGKPEDLVEGVRRGIDMFDCVMPTRNARNGHLFVSDGIVKIRNAKYREDTSPLDPECDCYTCKHYTKAYLYHLDKCGEILGARLNTIHNLRYYQRLMAQIRQAIEEDRFEAFVQEFYAKMGKPVPPMQSEIKSDEG

tgt

Queuine tRNA-ribosyltransferase

385 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

44.093 kDa

MKYELKKTNGNARRGRLTFSRPKGEYHVETPAFMPVGTYGTVKGMTPEEVAQTGAQILLGNTFHLWLRPGQEIMRQHGDLHDFMQWHGPILTDSGGFQVFSLGKLRKIKEEGVYFQNPISGEKVFLSPEKSMEIQYDLGSDIVMIFDECTPYPATFDYAKQSMEMSLRWAKRSRDRFDELQNPNALFGIIQGGVYEELRKVSVEKLVEIGFDGYAVGGLAVGEPKEDMHRILEYVCPQIPADKPRYLMGVGKPEDLVEGVRRGIDMFDCVMPTRNARNGHLFVTNGIVKIRNAKYRNDISPLDPECDCYTCKNYTKAYLYHLDKCGEILGARLNTIHNLRYYQRLMAEIRQAIDEDRFDDFVVEFYQRIGKEVPPLQLAKEGENA

tgt

Queuine tRNA-ribosyltransferase

385 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

42.925 kDa

MDPFRFQVEARAGRARVGRLFTPHGAVETPLFMPVGTAGSVKGLMPKDLEAIGSQVLLANTYHLLLRPGPERVRALGGLHGFAGWKGPWLTDSGGFQVMSLGHMRRIDEEGVVFQSHLDGRLIKLTPERSIAVQEALGADLIMAFDECPPYPSPREYLEASLERTLRWLERSLKAKTRPDQALFGIAQGGTDPELRRRSTLETIRFDLPGYAIGGLAVGEPKEAMFAMVELSTRLLPEDRPRYLMGVGHPEDLVAAMGLGVDLFDCVYPTRTGRFGSALVPEGRLNLKNARFLEDRRPLEEGCDCYTCQTFGRAYLAHLVRAGEMLGGILLSLHNLRHLHRLTEAARQAIREGRYGDFAREFARRRFGREVPPWFREALAAGGHW

tgt

Queuine tRNA-ribosyltransferase

385 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

42.826 kDa

MDPFRFQVEARAGRARVGRLFTPHGAVETPLFMPVGTAGSVKGLMPKDLEAIGSQVLLTNTYHLLLRPGPERVRALGGLHGFAGWKGPWLTDSGGFQVMSLGHMRRIDEEGVVFQSHLDGRLIKLTPERSIAVQEALGADLIMAFDECPPYPSPREYLEASLERTLRWLERSLKAKTRPDQALFGIAQGGTDPELRRRSTLETIRFDLPGYAIGGLAVGEPKEAMFAMVELSTRLLPEDRPRYLMGVGHPEDLVAAMGLGVDLFDCVYPTRTGRFGSALVPEGRLNLKNARFLEDRRPLEEGCDCYTCQTFGRAYLAHLVRAGEMLGGILLSLHNLRHLHRLTEAARQAIREGRYGDFAREFARRRFGREVPPWFREALAAGGHG

tgt

Queuine tRNA-ribosyltransferase

384 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

41.9 kDa

MSRLQFQLQATDGAARRGQLSFPCGTVQTPAFMPVGTYGAVKGVLPGQLCDLGAEIILGNTFHLFLRPGLEVIADHGGLHGFMRWNGPILTDSGGFQVFSLAHRRKISEQGVTFAAPTDGAQVFLGPEESMKIQKVLNSDIVMIFDECTPYPATEDVARDSMELSLRWAQRSRDAHDALDNDAALFGIIQGGVHPDLRGRSLDGLQAIGFDGYGIGGLAVGESESERNVILEYLHPRVPADRPRYLMGVGRPEDLVESVARGVDMFDCVMPTRHARNGQYFTGFGTVKIRNACYARDVDPIEPGCGCPACVGGYTRAYLRHLDRCNEMLASMLGTLHNLWYYETLMANMRAAITAGTFFAFRRSFYLARGLDLPPLPEVAGCAG

tgt

Queuine tRNA-ribosyltransferase

384 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

41.967 kDa

MSRLQFQLQATDGAARRGQLSFPCGTVQTPAFMPVGTYGAVKAVLPGQLCDLGAEIILGNTFHLFLRPGLEVIADHGGLHGFMRWNGPILTDSGGFQVFSLAHRRKISEQGVTFAAPTDGAQVFLGPEESMKIQKVLNSDVVMIFDECTPYPATEDVARDSMELSLRWAQRSRDAHDALDNDAALFGIIQGGVHPDLRGRSLDGLQAIGFDGYAIGGLAVGESESERNVILEYLHPRLPVDRPRYLMGVGRPEDLVESVARGVDMFDCVMPTRHARNGQYFTGFGTVKIRNACYARDVDPIEPGCGCPACVGGYTRAYLRHLDRCNEMLASMLGSLHNLWYYETLMANMRAAITAGTFFTFRHSFYLARGLDPPPLPEVASCAG

tgt

Queuine tRNA-ribosyltransferase

384 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

41.483 kDa

MFQFETTTACPDTKARTGKMTTAHGDVATPVFMPVGTLATVKSLSPEDLVACGAQIILGNTYHLYLRPGCDIIDAFSGVHAFMGWNRPLLTDSGGFQVFSLAKLSRITEEGAAFQSHLDGSSHLLTPESVIDIQNRLGSDIQMCLDQCIAFPAEKGAARDAANLTTRWAGRCRNRWQETGGPSRCGLFGIVQGGMFDDLRADSAGRLVDLDFSGYAVGGLSVGEPIETRLAVAEHTLSLLPPDRPRYIMGVGTPAELVELVALGADMFDCVMPTRNARNGKLFTSFGAINIRNACHAKETGPVDPACTCYTCTRFSRAYLRHLFMSRELLAYRLATLHNLFYYINLINDARAAVAAGRFAAFRKAFYAAQQATGPTGKEPCAGS

tgt

Queuine tRNA-ribosyltransferase

384 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.093 kDa

MDRQCAVASLTAFQFQIDRQCSQTRGRACSFHTPHGIVETPRFMPVGTLATVKTVTPAQLRDTGAQMVLSNTYHLHLQPGEEIVAKAGGLHRFMNWSGPMLTDSGGFQVFSLSELRKIEERGVTFRSPRDGAVIEFTPERSIRIQNALGADVIMAFDECPPYPAERKDVEAAVARTYRWLERCINAHERPQDQALFGIVQGGVYLDLRQQAARDLVQLDLPGYAIGGVSVGEPSEEIHRIVEATAPLLPAHKPRYLMGVGTYREMVQAIAAGIDLFDCVIPTRLARHGAALVKGDRWNLKNAQFREDFQPLDEDCNCYCCQNFSRAYLNHLIRSREILGYTLLSIHNITELVRFTTRIREAILSDRFVEEFGHWLQPSAVPVSP

tgt

Queuine tRNA-ribosyltransferase

384 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

42.854 kDa

MSMSFSFQVEATQGAARAGRMITPHGEVETPVFMPVGTVATVKGIPQDLLEELGVQILLNNTYHLYLRPGVEQIRKLGGTHKFMSWDRSILTDSGGFQVFSLSELRKVTEEGVSFRSHLDGSSHLFSPESAMASQIGIGADIIMAFDECTEYPAERTRTERSMELTLRWAERSKNAFEAHKHEVPWFAERGKKSQALFGIVQGGMFPNLRKESAERTVEIGFPGYALGGFSVGEPREKTAELVANTVPLLPENKPRYLMGVGYPEEIVQYARMGIDMMDCVLPTRAARHGLLFTSEGRLTIKNQRFASDEGPLDPNCSCKVCKRYSRAYLRHLYASNEVLAQVLNTTHNLSYYLDTMRRVRQAIILGENSVSLPVVRSPHLSAT

tgt

Queuine tRNA-ribosyltransferase

383 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

42.525 kDa

MLNFDLLTTDGLARRGRMTLNHGVVETPIFMPVGTYGAVKAMSPVELKDIGAQIILGNTFHLWLRPALEVIDAHKGLHGFVGWDKPMLTDSGGFQVFSLGDLRKITEEGVHFASPINGDRLFLSPEISMQIQRRLNSDIVMQFDECTPYQIDGRPATEAEAAASMRMSLRWAQRSRNEFERERNPNALFGIVQGGMFEPLRDESLAGLQAIDADAGGQGFGGYAIGGLSVGEPKEDMIRVLQHVAPRLPANKPHYLMGVGTPEDLVAGVAAGIDMFDCVMPTRNARNGWLFTRFGDIKIKNAVHRNDPRPLDETCGCYTCRNFSRAYLHHLQRVGEILGARLNTIHNLHYYLELMADMRTAIESHSFAVFRARFAADRARGAL

tgt

Queuine tRNA-ribosyltransferase

383 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

44.349 kDa

MRFKILQKDGLARTGIIETQRGIIHTPAFMPVGTNGTVKAMTPEEVRQIGYEIILSNTYHLYLRPGHETIKMIGGIHKFINWHCPILTDSGGFQIYSLASLRKITLEGVEFRSHIDGSLHFINPEKAIDIQLALGSDIMMVLDECIPYPADEEYVEKSIKLTTEWAKRCKEHFEKQDTYQALFGIIQGGVFSDLRIRALEELLKIDFHGYAIGGLSVGEPKTDMYKIVKDISPLMPEDKPHYLMGVGDLIDVLHAVEHGIDMFDCVIPTRNARNGTLFTSQGRISIKRSEFKEDLSPLDPDCDCYTCKNYSRAFLRHLYTCREILSMRLNTIHNLYFYCRFFEKMRQAIAERRFQEFKKEWLPVLEKNFYQESNDFHHSLENY

tgt

Queuine tRNA-ribosyltransferase

383 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.068 kDa

MQFVLHKTASGVTRARRGTVHLNHGDVQTPAFMPVGTYGTVKGMLPRDIEAIGADIILGNTFHLWLRPGTDIIDKFGGLHKFMHWDKPILTDSGGFQVFSLGAMRKITEEGVTFKSPIDGAKVFLSPEKSMQIQYSLNSDIVMQFDECTPYPATHDEAKKSLELSLRWGQRCVDEHKKLGSTNALFGIIQGSMYADLRKQSLEGLLEIGFDGYAIGGLSVGEPKEEMIDVLDYIANDMPADKPRYLMGVGKPEDLVEGVRRGVDMFDCVMPTRNARNGHYFVTGDVDNAGVVRIRNSQYRTDEGPLDPECDCYTCQNFSRAYLSHLNKCKEMLGAQLATIHNLRYYQRLMQGIRDAIEQDKFDEFVTEFYSKRGQTVPELNLR

tgt

Queuine tRNA-ribosyltransferase

383 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.097 kDa

MQFVLHKTASGVTRARRGTVHLNHGDVQTPAFMPVGTYGTVKGMLPRDIEAIGADIILGNTFHLWLRPGTDIIDKFGGLHKFMHWDKPILTDSGGFQVFSLGAMRKITEEGVTFKSPIDGAKVFLSPEKSMQIQYSLNSDIVMQFDECTPYPATHDEAKKSLELSLRWGQRCVDEHKNLGSTNALFGIIQGSMYADLRKQSLEGLLEIGFDGYAIGGLSVGEPKEEMIDVLDYIADDMPADKPRYLMGVGKPEDLVEGVRRGVDMFDCVMPTRNARNGHYFVTGDADNAGVVRIRNSQYRTDEGPLDPECDCYTCQNFSRAYLSHLNKCKEMLGAQLATIHNLRYYQRLMQNIRDAIEQDKFDEFVNEFYSKRGQTVPELNLR

tgt

Queuine tRNA-ribosyltransferase

383 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.446 kDa

MQFTLHKTAAGESRARRGTVTVNHGEIRTPAFMPVGTYGTVKGMLPRDIEDIGADIILGNTFHLWLRPGTEVIDKFGGLHQFMNWNKPILTDSGGFQVFSLGAMRKITEEGVAFKSPIDGAKVFLSPEKSMQIQYSLNSDIVMQFDECTPYPATYSEAQKSLELSLRWGQRCVDEHKKLGNTNALFGIVQGSMYEDLRRQSMDGLLEIGFDGYAIGGLSVGEPKEEMISVLNYMPELMPADKPRYLMGVGKPEDILEAVRRGVDMFDCVMPTRNARNGHYFVTGNEDNQGIVRIRNSQYREDQGPLDPECDCYCCQNFSRAYLYHLNKCKEMLGAQLATIHNLRYYQRLMQGIRDAIDEDRFDEFVADFYHRRGQDVPPLELK

tgt

Queuine tRNA-ribosyltransferase

383 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

42.357 kDa

MLKYELLTTDGLARRGRMTLNHGVVETPIFMPVGTYGAVKAMSPAELKDIGAQIILGNTFHLWLRPGLEVMDAHKGLHGFNGWDKPILTDSGGFQVFSLGDLRKITEDGVTFASPINGDKLFLSPEISMQIQRRLNSDIVMQFDECTPYKIGDRPATEAEAAASMRMSLRWAQRSRNEFEREKNPNALFAIVQGGMFENLRDESLAGLQAIDADAGGEGFGGYAIGGLSVGEPKEDMMRVLQHVAPRLPADKPHYLMGVGTPEDLVAGVAAGVDMFDCVMPTRNARNGWLFTRFGDIKIKNAVHRNDPRPLDETCGCYTCSNFSRAYLHHLQRVGEILGARLNTIHNLYYYLELMAEMRTAIESHGFAAFQARFAADRARGAL

tgt

Queuine tRNA-ribosyltransferase

383 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.432 kDa

MTAAITYEHIKTCKQSGARLGRVHTPHGTIETPMFMPVGTLATVKTMSPEDLKAMDAQIILSNTYHLWLRPGEEIIKEAGGLHQFMNWDKPILTDSGGFQVFSLSDLRKITEEGVHFRNHLSGEKLFLSPEKAMQIQHVLGSDIMMAFDECPPYPADHSYMKASVERTSRWAERCLAEHKRSGKDSVQGLFGIIQGGEYEDLRKQSANDLTALDFPGYAVGGLSVGEPKDVMNHVLEFTTPLMPEDKPRYLMGVGSPDSLIDGAIRGIDMFDCVLPTRIARNGTCMTSAGRLVVRNAKYARDFSPLDEKCDCHVCRTYSRAYIRHLIKCEETFGFRLTTYHNLYFLLNLMKQVRQAIMDDCLLDFREQFFEEYGFNKENARNF

tgt

Queuine tRNA-ribosyltransferase

382 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.359 kDa

MKYELKTTSGNARRGRLTFSRPKGEYVVETPAFMPVGTYGTVKGMTPEEVAATGAQILLGNTFHLWLRPGQEVMKSHGDLHGFMQWHGPILTDSGGFQVFSLGKLRKIKEEGVTFQNPISGEKIFLSPEKSMEIQYDLGSDIVMIFDECTPYPATFDYAKNSMEMSLRWAKRSRDRFDELQNPRALFGIVQGGTYEELRKISVEGLVNIGFDGYAVGGLAVGEPKEEMHRILEFTTPLLPQDKPRYLMGVGKPEDLVEGVRRGIDMFDCVMPTRNARNGHLFVSNGIVKIRNAKYKTDTTPLDPECDCYTCKNYTKAYLYHLDKCGEILGARLNTIHNLRYYQRLMAQIRQAIEEDRFDDFVVEFYAKIGKEVPPLQSEVNK

tgt

Queuine tRNA-ribosyltransferase

382 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.359 kDa

MKYELKTTSGNARRGRLTFSRPKGEYVVETPAFMPVGTYGTVKGMTPEEVAATGAQILLGNTFHLWLRPGQEVMKSHGDLHGFMQWHGPILTDSGGFQVFSLGKLRKIKEEGVTFQNPISGEKIFLSPEKSMEIQYDLGSDIVMIFDECTPYPATFDYAKNSMEMSLRWAKRSRDRFDELQNPRALFGIVQGGTYEELRKISVEGLVNIGFDGYAVGGLAVGEPKEEMHRILEFTTPLLPQDKPRYLMGVGKPEDLVEGVRRGIDMFDCVMPTRNARNGHLFVSNGIVKIRNAKYKTDTTPLDPECDCYTCKNYTKAYLYHLDKCGEILGARLNTIHNLRYYQRLMAQIRQAIEEDRFDDFVVEFYAKIGKEVPPLQSEVNK

tgt

Queuine tRNA-ribosyltransferase

382 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.332 kDa

MKYELKTTSGNARRGRLTFSRPKGEYVVETPAFMPVGTYGTVKGMTPEEVAATGAQILLGNTFHLWLRPGQEVMKSHGDLHGFMQWHGPILTDSGGFQVFSLGKLRKIKEEGVTFQNPISGEKIFLSPEKSMEIQYDLGSDIVMIFDECTPYPATFDYAKNSMEMSLRWAKRSRDRFDELQNPRALFGIVQGGTYEELRKISAEGLVDIGFDGYAVGGLAVGEPKEEMHRILEFTTPLLPQDKPRYLMGVGKPEDLVEGVRRGIDMFDCVMPTRNARNGHLFVSNGIVKIRNAKYKTDTTPLDPECDCYTCKNYTKAYLYHLDKCGEILGARLNTIHNLRYYQRLMAQIRQAIEEDRFDDFVVEFYAKIGKEVPPLQSEVNK

tgt

Queuine tRNA-ribosyltransferase

382 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.489 kDa

MMKYELKSTSGMARRGRLTFSRPQGECYVETPAFMPVGTYGTVKGMTPEEVKATGAQILLGNTFHLWLRPGQEIMKMHGDLHDFMQWHGPILTDSGGFQVLSLGKLRKIKEEGVTFQNPISGEKIFLSPEKSMEIQYDLGSDIVMIFDECTPYPATLEYAKKSMEMSLRWAKRSRTRFDELANPRALFGIVQGSTYEELRRESVKGLINIGFDGYAVGGLAVGEPKEEMHRILEFTTPLLPQDKPRYLMGVGKPEDLVEGVRRGIDMFDCVMPTRNARNGHLFVSDGVVKIRNAKYKNDTTPLDAECDCYTCKNYTKAYLYHLDKCGEILGARLNTIHNLRYYQRLMAQIRQAIEQDCFDEFVVEFYAKIGKEVPPLHLKSE

tgt

Queuine tRNA-ribosyltransferase

382 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.608 kDa

MKYELDKTSGNARRGRLVFERPQGTFSVETPAFMPVGTYGTVKGMTPEEVRATGAEILLGNTFHLWLRPGQEIMRKHGDLHDFMQWHRPILTDSGGFQVFSLGKLRKITEEGVKFQNPINGERIFLSPEKSMEIQYDLGSDIVMIFDECTPYPATFDYAKKSMEMSLRWAKRSHDRFDELGNKNALFGIIQGGVFEELRKVSLEGLVNIGFDGYAVGGLAVGEPKEDMHRILEYICPQIPADKPRYLMGVGKPEDLVEGVRRGIDMFDCVMPTRNARNGHLFVTDGIVKIRNAKYRDDTSPLDPECDCYTCKNYTKAYLYHLDKCGEILGARLNTIHNLRYYQRLMAEIRQAIEDDRFDDFVVEFYARMGKPVPPLQLADNS

tgt

Queuine tRNA-ribosyltransferase

382 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.641 kDa

MKYELDKTSGNARRGRLVFERPQGTFSVETPAFMPVGTYGTVKGMTPEEVRATGAEILLGNTFHLWLRPGQEIMRKHGDLHDFMQWHRPILTDSGGFQVFSLGKLRKITEEGVKFQNPINGERIFLSPEKSMEIQYDLGSDIVMIFDECTPYPATFDYAKKSMEMSLRWAKRSRDRFDELGNKNALFGIIQGGVFEELRKVSLEGLVNIGFDGYAVGGLAVGEPKEDMHRILEYICPQIPADKPRYLMGVGKPEDLVEGVRRGIDMFDCVMPTRNARNGHLFVTDGIVKIRNAKYRDDTSPLDPECDCYTCKNYTKAYLYHLDKCGEILGARLNTIHNLRYYQRLMAEIRQAIEDDRFDDFVVEFYARMGKPVPPLQLADKS

tgt

Queuine tRNA-ribosyltransferase

382 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.597 kDa

MKYELDKTSGNARRGRLVFERPQGTFSVETPAFMPVGTYGTVKGMTPEEVRATGAEILLGNTFHLWLRPGQEIMRKHGDLHDFMQWHRPILTDSGGFQVFSLGKLRKITEEGVKFQNPINGERIFLSPEKSMEIQYDLGSDIVMIFDECTPYPATFDYAKKSMEMSLRWAKRSRARFDELGNKNALFGIIQGGVFEELRKVSLEGLVNIGFDGYAVGGLAVGEPKEDMHRILEYICPQIPADKPRYLMGVGKPEDLVEGVRRGIDMFDCVMPTRNARNGHLFVTDGIVKIRNAKYRDDTSPLDPECDCYTCKNYTKAYLYHLDKCGEILGARLNTIHNLRYYQRLMAEIRQAIEDDRFDDFVVEFYARMGKPVPPLQLADKS

tgt

Queuine tRNA-ribosyltransferase

382 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.627 kDa

MKYELDKTSGNARRGRLVFERPQGTFSVETPAFMPVGTYGTVKGMTPEEVRATGAEILLGNTFHLWLRPGQEVMRKHGDLHDFMQWHRPILTDSGGFQVFSLGKLRKITEEGVKFQNPINGERIFLSPEKSMEIQYDLGSDIVMIFDECTPYPATFDYAKKSMEMSLRWAKRSRDRFDELGNKNALFGIIQGGVFEELRKVSLEGLVNIGFDGYAVGGLAVGEPKEDMHRILEYICPQIPADKPRYLMGVGKPEDLVEGVRRGIDMFDCVMPTRNARNGHLFVTDGIVKIRNAKYRDDTSPLDPECDCYTCKNYTKAYLYHLDKCGEILGARLNTIHNLRYYQRLMAEIRQAIEDDRFDDFVVEFYARMGKPVPPLQLADKS

tgt

Queuine tRNA-ribosyltransferase

382 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.335 kDa

MEYQLLKTDGQARRGRLVFDRGVVETPAFMPVGTYGTVKGMTPEEVKETGAQILLGNTFHLWLRPGQAVMKLHGDLHDFMQWHGPILTDSGGFQVFSLGDIRKITEEGVYFRNPINGDTIFLSPEKSMEIQYDLGSDIVMIFDECTSYPSDWDYAKQSMEMSLRWAARSRQRFDELGNHNALFGIIQGSVYEDLRDVSVKRLVEIGFDGYAVGGLAVGEPKADMHRILAHLCPQIPADKPRYLMGVGKPEDLVEGVRRGIDMFDCVMPTRNARNGHLFVTDGVVKIRNARYKDDVAPLDAECDCYTCRNYSRAYLHHLDRCNEILGARLNTIHNLRYYQRLMAGLRQAIDEGKLEHFVGEFYRRTGKPAPPLVVELHNNEGI

tgt

Queuine tRNA-ribosyltransferase

382 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.342 kDa

MTEHAIKYRLIKKEKHTGARLGEIITPHGTFPTPMFMPVGTQATVKTMSPEELKTLGSGIILSNTYHLWLRPGDELVAEAGGLHKFMNWDQPILTDSGGFQVYSLVQNKKNITEEGVKFKSHLDGRELFLNPEKAISIQNNLGSDIMMSFDECPPFYQPYDYVKASVERTSRWAERGLNAHRRPNDQGLFGIVQGAGFEDLRRQSARDLTSMDFAGYSIGGLAVGESHKEMNAVLDFTTPMLPEDKPRYLMGVGAPDSLIDGVIRGVDMFDCVLPTRIARNGTLMTHFGRVNIRNAKYEHDFTPLDPMCDCYTCTNYTRAYLRHLIKADETFGLRLCSYHNLHFLVNLMKDVRGAIMDDNLLEFREDFCERYGYNQPNAKDF

tgt

Queuine tRNA-ribosyltransferase

382 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.37 kDa

MTEHAIKYRLIKKEKHTGARLGEIITPHGTFPTPMFMPVGTQATVKTMSPEELKTLGSGIILSNTYHLWLRPGDELVAEAGGLHKFMNWDQPILTDSGGFQVYSLVQNKKNITEEGVKFKSHLDGRELFLNPEKAISIQNNLGSDIMMSFDECPPFYQPYDYVKASVERTSRWAERGLNAHRRPNDQGLFGIVQGAGFEDLRRQSASDLTSMDFAGYSIGGLAVGESHKEMNAVLDFTTPMLPEDKPRYLMGVGAPDSLIDGVIRGVDMFDCVLPTRIARNGTLMTHFGRVNIRNAKYEYDFTPLDPMCDCYTCTNYTRAYLRHLIKADETFGLRLCSYHNLHFLVNLMKDVRQAIMDDNLLEFREDFCERYGYNQPNAKDF

tgt

Queuine tRNA-ribosyltransferase

382 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.344 kDa

MTEHAIKYRLIKKEKHTGARLGEIITPHGTFPTPMFMPVGTQATVKTMSPEELKTLGSGIILSNTYHLWLRPGDELVAEAGGLHKFMNWDQPILTDSGGFQVYSLVQNKKNITEEGVKFKSHLDGRELFLNPEKAISIQNNLGSDIMMSFDECPPFYQPYDYVKASVERTSRWAERGLNAHRRPNDQGLFGIVQGAGFEDLRRQSASDLTSMDFAGYSIGGLAVGESHKEMNAVLDFTTPMLPEDKPRYLMGVGAPDSLIDGVIRGVDMFDCVLPTRIARNGTLMTHFGRVNIRNAKYEHDFTPLDPMCDCYTCTNYTRAYLRHLIKADETFGLRLCSYHNLHFLVNLMKDVRQAIMDDNLLEFREDFCERYGYNQPNAKDF

tgt

Queuine tRNA-ribosyltransferase

381 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.365 kDa

MKYELQTTDGRARRGRLIFERGVVETPAFMPVGTYGTVKGMTPEEVKETGAQILLGNTFHLWLRPGQEIMKLHGDLHDFMNWHGPILTDSGGFQVFSLGDIRKITEQGVHFRNPINGDSIFLSPEKSMEIQNDLGSDIVMIFDECTPYPADWDYAKRSMEMSLRWAKRSRQRFDELENKNALFGIIQGSVYEDLRDVSVKGLVDIGFDGYAVGGLAVGEPKEDMHRILEHVCPQIPEDKPRYLMGVGKPEDLVEGVRRGVDMFDCVMPTRNARNGHLFVTDGVVKIRNAKHKDDVSSLDEHCDCYTCRNYSRAYLHHLDRCNEILGARLNTIHNLRYYQRLMAGLRQAIEEGKLELFVVDFYQRIGKPIPPLAEKDVAASN

tgt

Queuine tRNA-ribosyltransferase

381 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.419 kDa

MKYELQTTDGRARRGRLIFERGVVETPAFMPVGTYGTVKGMTPEEVKDTGAQILLGNTFHLWLRPGQEIMKLHGDLHDFMQWHGPILTDSGGFQVFSLGDIRKITEQGVHFRNPINGDSIFLSPEKSMEIQHDLGSDIVMIFDECTPYPADWDYAKRSMEMSLRWAKRSRQRFDELENKNALFGIIQGSVYEDLRDVSVKGLVDIGFDGYAVGGLAVGEPKEDMHRILEHVCPQIPEDKPRYLMGVGKPEDLVEGVRRGVDMFDCVMPTRNARNGHLFVTDGVVKIRNAKYKDDVSPLDEHCDCYTCRNYSRAYLHHLDRCNEILGARLNTIHNLRYYQRLMAGLRQAIEEGKLEHFVVDFYQRIGKPIPPLAEKDVAAGN

tgt

Queuine tRNA-ribosyltransferase

381 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

42.126 kDa

MSRLQFQLQATDGHARRGRLTFPRGTVETPAFMPVGTYGSVKGILPEQIRALGAEIILGNTFHLYLRPGLEVIGDHGGLHGFARWDGPILTDSGGFQVFSLAHRRKITEQGVTFSSPTDGARVFLGPEESMKIQKVLDSDIVMIFDECTPYPATEDVARRSMELSLRWAQRSRDAHDGLGNDAALFGIVQGGVHPDLRSRSLDGLQAIGFDGYAIGGLAVGEPEHERNAMLEHLHPRLPAERPRYLMGVGRPEDLVEGVARGVDMFDCVMPTRNARNGHYFTSFGTVRIRNAKYERDLDTIEPGCGCHACSSGYTRAYLRHLDRCNEMLAPMLGTLHNLWYYEKLMADMRAAIASGTFVEFRRSFYAARGATTPPLPGETS

tgt

Queuine tRNA-ribosyltransferase

381 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

42.029 kDa

MSRLQFQLQATDGHARRGRLTFPRGTVETPAFMPVGTYGSVKGILPEQIRALGAEIILGNTFHLYLRPGLEVIGDHGGLHGFARWDGPILTDSGGFQVFSLAHRRKITEQGVTFSSPTDGARVFLGPEESMKIQKVLDSDIVMIFDECTPYPATEDVARRSMELSLRWAQRSRDAHDGLGNDAALFGIVQGGVHPDLRSRSLDGLQGIGFDGYAIGGLAVGEPEHERNAMLEHLHPRLPAERPRYLMGVGRPEDLVEGVARGVDMFDCVMPTRNARNGHYFTSFGTVRIRNAKYERDLDTIEPGCGCHACSSGYTRAYLRHLDRCNEMLAPMLGTLHNLCYYEKLMADMRAAIASGTFVEFRRSFYAARGATTPPLPGETS

tgt

Queuine tRNA-ribosyltransferase

381 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

42.138 kDa

MSRLQFQLQTTDGHARRGRLTFPRGTVETPAFMPVGTYGSVKGILPEQIRALGAEIILGNTFHLYLRPGLDVIGDHGGLHGFARWDGPILTDSGGFQVFSLAHRRKITEQGVTFSSPNDGARVFLGPEESMQIQKVLDSDIVMIFDECTPYPATEDVARRSMELSLRWAQRSRQAHDGLGNDAALFGIVQGGVHPDLRSRSLDGLQAIGFDGYAIGGLAVGEPEHERNAMLEHLHPRLPAERPRYLMGVGRPEDLVEGVARGVDMFDCVMPTRNARNGHYFTSFGTVRIRNAKYERDLDTIEPGCGCHACSSGYTRAYLRHLDRCNEMLAPMLGTLHNLWYYEKLMADMRAAIAAGTFVEFRRSFYAARGATTPPLPGESS

tgt

Queuine tRNA-ribosyltransferase

381 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

42.125 kDa

MSRLQFQLQTTDGHARRGRLTFPRGTVETPAFMPVGTYGSVKGILPEQIRALGAEIILGNTFHLYLRPGLDVIGDHGGLHGFARWDGPILTDSGGFQVFSLAHRRKITEQGVTFSSPTDGARVFLGPEESMQIQKVLDSDIVMIFDECTPYPATEDVARRSMELSLRWAQRSRQAHDGLGNDAALFGIVQGGVHPDLRSRSLDGLQAIGFDGYAIGGLAVGEPEHERNAMLEHLHPRLPAERPRYLMGVGRPEDLVEGVARGVDMFDCVMPTRNARNGHYFTSFGTVRIRNAKYERDLDTIEPGCGCHACSSGYTRAYLRHLDRCNEMLAPMLGTLHNLWYYEKLMADMRAAIAAGTFVEFRRSFYAARGATTPPLPGESS

tgt

Queuine tRNA-ribosyltransferase

381 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

42.138 kDa

MSRLQFQLQTTDGHARRGRLTFPRGTVETPAFMPVGTYGSVKGILPEQIRALGAEIILGNTFHLYLRPGLDVIGDHGGLHGFARWDGPILTDSGGFQVFSLAHRRKITEQGVTFSSPNDGARVFLGPEESMQIQKVLDSDIVMIFDECTPYPATEDVARRSMELSLRWAQRSRQAHDGLGNDAALFGIVQGGVHPDLRSRSLDGLQAIGFDGYAIGGLAVGEPEHERNAMLEHLHPRLPAERPRYLMGVGRPEDLVEGVARGVDMFDCVMPTRNARNGHYFTSFGTVRIRNAKYERDLDTIEPGCGCHACSSGYTRAYLRHLDRCNEMLAPMLGTLHNLWYYEKLMADMRAAIAAGTFVEFRRSFYAARGATTPPLPGESS

tgt

Queuine tRNA-ribosyltransferase

381 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

42.114 kDa

MSRLQFQLQATDGHARRGRLTFPRGTVETPAFMPVGTYGSVKGILPEHIRALGAEIILGNTFHLYLRPGLDVIGDHGGLHGFARWDGPILTDSGGFQVFSLAHRRKITEQGVTFSSPTDGARVFLGPEESMKIQKVLDSDIVMIFDECTPYPATEDLARRSMELSLRWAQRSRDAHDGLGNDAALFGIVQGGVHPDLRSRSLDGLQSIGFDGYAIGGLAVGEPEHERNAMLEHLHPRLPAECPRYLMGVGRPEDLVEGVARGVDMFDCVMPTRNARNGHYFTSFGTVRIRNAKYERDLDTIEPGCGCHACSSGYTRSYLRHLDRCNEMLAPMLGTLHNLWYYEKLMADMRAAIASGTFVEFRRSFYAARGATTPPLPGETS

tgt

Queuine tRNA-ribosyltransferase

381 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

42.114 kDa

MSRLQFQLQATDGHARRGRLTFPRGTVETPAFMPVGTYGSVKGILPEHIRALGAEIILGNTFHLYLRPGLDVIGDHGGLHGFARWDGPILTDSGGFQVFSLAHRRKITEQGVTFSSPTDGARVFLGPEESMKIQKVLDSDIVMIFDECTPYPATEDLARRSMELSLRWAQRSRDAHDGLGNDAALFGIVQGGVHPDLRSRSLDGLQSIGFDGYAIGGLAVGEPEHERNAMLEHLHPRLPAECPRYLMGVGRPEDLVEGVARGVDMFDCVMPTRNARNGHYFTSFGTVRIRNAKYERDLDTIEPGCGCHACSSGYTRSYLRHLDRCNEMLAPMLGTLHNLWYYEKLMADMRAAIASGTFVEFRRSFYAARGATTPPLPGETS

tgt

Queuine tRNA-ribosyltransferase

381 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

42.114 kDa

MSRLQFQLQATDGHARRGRLTFPRGTVETPAFMPVGTYGSVKGILPEHIRALGAEIILGNTFHLYLRPGLDVIGDHGGLHGFARWDGPILTDSGGFQVFSLAHRRKITEQGVTFSSPTDGARVFLGPEESMKIQKVLDSDIVMIFDECTPYPATEDLARRSMELSLRWAQRSRDAHDGLGNDAALFGIVQGGVHPDLRSRSLDGLQSIGFDGYAIGGLAVGEPEHERNAMLEHLHPRLPAECPRYLMGVGRPEDLVEGVARGVDMFDCVMPTRNARNGHYFTSFGTVRIRNAKYERDLDTIEPGCGCHACSSGYTRSYLRHLDRCNEMLAPMLGTLHNLWYYEKLMADMRAAIASGTFVEFRRSFYAARGATTPPLPGETS

tgt

Queuine tRNA-ribosyltransferase

381 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

42.842 kDa

MQVTLQAQDGGARALSLKLAHSEVQTPVFMPVGTQGCVKALDSRDMSEILNAQIILVNTYHMYLRIGIERLKNFGGIARFAHFDRSYLSDSGGFQAFSLNKNAKVTNEGVAFKSHIDGSKHFFSPEYVLDIQYALNSDIMMVLDDLVGLPSSEERIADSIARTSDWAQKSLIYHQSQKARGLGLNNNLFAIIQGGVNEHFRTLCAKQLVDMGDFDGFAIGGLAVGETSEQMYKTISFTTPLMPVNKPRYLMGVGTPENIIESIALGVDMFDCVMPTRNARNATLFTHFGKINIKAAIFSNDQSPIDELCDCYTCQHFTRAYLCHLFRSQEMTYYRLASLHNLHYYLNLMREAREAILQGTFSAYRSSFYALREMEIPNNEY

tgt

Queuine tRNA-ribosyltransferase

381 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.407 kDa

MTEPAIRYRLIKKDKHTGARLGELITPHGTFPTPMFMPVGTLATVKTMSPEELKEMGAGVILSNTYHLWLRPGEDLVEEAGGLHKFMNWDQPILTDSGGFQVFSLSDMRKIEEEGVHFRNHLNGSKMFLSPEKAINIQNKLGSDIMMSFDECPPFDESYEYVKRSIERTSRWAERGLKAHANPDRQGLFGIVQGAGFEDLRRQSAKDLVSMDFPGYSIGGLSVGESKEEMNRVLDFTTPLIPENKPRYLMGVGAPDSLIDGVIRGIDMFDCVLPTRIARNGTCMTSQGRLVVKNAQYARDFRPLDEKCDCYVCRNYTRAYIRHLIKCDETFGIRLTSYHNLYFLLDLMKNVRQAIMDDNLLEFRQAFFEEYGFNKANAKSF

tgt

Queuine tRNA-ribosyltransferase

381 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

42.297 kDa

MNDSLQAIPNQPFSFFTQASCSHTQARAGQFFTPHGVVETPRFMPVGTLANIKTVTPEQLRGTGAQMILANTYHLHLQPGEGIVAAAGGLHRFMGWTGPILTDSGGFQVFSLSELRSIAEAGVTFRSPRDGEEIYLSPEKAIAIQNQLGADVIMAFDECAPYPADRSTVTEAVERTTRWLERCCKAHDRVEDQALFGIIQGGTYGDLRQQSARSLVEFDLPGYAIGGVSVGEPPELIEKIVKFTTPLLPEHKPRYLMGVGTYREMVQAIAAGIDLFDCVIPTRLARHGNALVRGERWNLKNSRFREDFQPLDQSCACYTCQNFSRAYLSHLLRARELLAYTLLSIHNITELISFTQKIRQAILHDRFSSEFASWLTSPSPS

tgt

Queuine tRNA-ribosyltransferase

381 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.37 kDa

MTQPAIRYELLHTCKQTGARLGIVHTPHGSFETPAFMPVGTQATVKTMSPEELKEMNAGIILSNTYHLWLRPGNDIVKEAGGLHKFMNWDRPILTDSGGFQVFSLSQFRKIEEEGVHFRNHLNGDKLFLSPEKAMEIQNDLGSDIMMAFDECPPYPATHEYMLQSVDRTTRWAKRCKEAHSRPEEQGLFGIIQGGEYEDLRRRSAEALVELDFPGYAIGGLSVGEPKDIMNRVLEFTTPLMPANKPRYLMGVGSPDSLIDGAIRGVDMFDCVLPTRIARNGTLMTSEGRLVVKNAKYARDFGPIDPNCDCYTCKNYSRAYIRHLIRTEETFGIRLTSYHNLHFLLKLMEQVREAIRQDRLGDFREEFFEKYGFNGPNAKNF

tgt

Queuine tRNA-ribosyltransferase

381 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.615 kDa

MSQQPIRYEFIKACKQTGARLGRVHTPHGSFETPVFMPVGTLATVKTMSPEELKEMGADIILSNTYHLWLRPGHDIVKEAGGLHQFMNWNRAILTDSGGFQVFSLSEFRKIEEEGVHFRNHLNGDKLFLSPEKAMEIQNALGSDIMMAFDECPPYPAEYDYMKKSVERTSRWAERCLKAHNRPDEQGLFGIVQGGEYENLRKQSAKDLISLDFPGYAIGGLSVGEPKDVMNRVLEFTTPLLPADKPRYLMGVGSPDSLIDGAIRGVDMFDCVLPTRIARNGTLMTSEGRLVVKNAKYERDFRPIDEQCDCYTCRNYSRAYIRHLIRCNETFGIRLTSYHNLYFLLKLMGQVRDAIREDRLGDFREEFFERYGFNKPNAKSF

tgt

Queuine tRNA-ribosyltransferase

381 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.575 kDa

MSQLPIRYEFIKSCKQTGARLGRVHTPHGSFDTPVFMPVGTLATVKTMAPEELKAMEAGIILSNTYHLWLRPGHDIVKEAGGLHKFMNWDRAILTDSGGFQVFSLSEFRKIEEEGVHFRNHLNGDKLFLSPEKAMDIQNALGSDIMMAFDECPPYPAEYDYMKRSVERTSRWAERCLTAHQRPEDQGLFGIIQGGEYEELRKQSAKDLVSLDFPGYAIGGLSVGEPKDVMNRVLEFTTPLLPADKPRYLMGVGSPDSLIDGAIRGVDMFDCVLPTRIARNGTLMTSEGRLVVKNAKYERDFRPIDENCDCYTCKNYTRAYIRHLIKTNETFGIRLTTYHNLHFLLKLMEQVREAIREDRLGDFKEEFFERYGFNEPNAKNF

tgt

Queuine tRNA-ribosyltransferase

381 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.711 kDa

MAEQPIRYEFIKECKQTGARLGKVHTPHGSFETPVFMPVGTLATVKTMSPEELKAMDAGIILSNTYHLWLRPGQDIVKEAGGLHKFMNWDRAILTDSGGFQVFSLSKFRNIEEEGVHFRNHLNGDKLFLSPEKAMEIQNALGSDIMMAFDECPPYPAEYDYMKRSVERTSRWAERCLNAHNRQDEQGLFGIVQGGEYEDLRTQSAKDLISLDFPGYAIGGLSVGEPKDVMNRVLEFTTPLLPKDKPRYLMGVGSPDALIDGAIRGVDMFDCVLPTRIARNGTVFTAEGRLNMKNAKFERDFRPIDEECDCYTCKNYTRAYIRHLIRCNETFGLRLTTYHNLHFLLHLMEQVRQAIREDRLGDFREEFFERYGYNKPNAKSF

tgt

Queuine tRNA-ribosyltransferase

381 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.666 kDa

MAEQPIRYEFIKECKQTGARLGRVHTPHGSFETPVFMPVGTLATVKTMSPDELKSMDAGIILSNTYHLWLRPGHDIVKEAGGLHKFMNWDRAILTDSGGFQVFSLSKFRNIEEEGVHFRNHLNGDKLFLSPEKAMEIQNALGSDIMMAFDECPPYPAEYDYMKRSVERTSRWAERCLEAHGRSDEQGLFGIVQGGEYEDLRTQSAKDLVSLDFPGYAIGGLSVGEPKHVMNRVLEFTTPLLPKDKPRYLMGVGSPDALIDGAIRGVDMFDCVLPTRIARNGTVFTNEGRLNMKNAKYERDFRPIDEECSCHTCKNYSRAYIRHLIRCNETFGIRLTTYHNLHFLLHLMEQVRQAIREDRLGDFREEFFERYGYNKPNAKSF

tgt

Queuine tRNA-ribosyltransferase

380 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.206 kDa

MEPAIKYRLIKTDKHTGARLGEIITPHGTFPTPIFMPVGTQATVKAMSPEELEDLGADIILSNTYHLWVRPGEDIVKEGGGLHQFMNWKKGILTDSGGFQVFSLAKLRDITEEGVHFKNELNGANMFLSPEKAIQIENDLGPDIMMSFDECPPYFESYDYVKHSVERTSRWAERGLKAHRNPETQGLFGIIQGAGFEDLRRQSAKDLVSMDFPGYSIGGLSVGESKEEMNRVLDFTTQLIPENKPRYLMGVGSPDALIDGVLRGVDMFDCVLPTRIARNGTCMTSHGRLVVKNAKYARDFTPIDDNCQCYTCRNYTRAYIRHLIKTDETFGLRLTSIHNVYFLVHLMKDVRQAIMDDNLLEFRQNFFEEYGYNKENSKNF

tgt

Queuine tRNA-ribosyltransferase

380 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.27 kDa

MTTPIRFELIKTCRQTGARLGILHTPHGSFETPMFMPVGTLATVKTLSPEELKEMGAGVILSNTYHLWLRPGHDIVEEAGGLHAFMNWDRGILTDSGGFQVFSLSEFRRIEEEGVYFRNHLNGDKLFLSPEKAVEIQNALGADIIMAFDECPPYPATYEYMKQSIERTSRWAERCLKAHRRPNEQGLFGIVQGGEYEELRRQSARDLVSLDFPGYAVGGLSVGEPKEVMNRVLEFTTPLLPADKPRYLMGVGSPDSLIDGAIRGIDMFDCVLPTRIGRNGTVMTSEGRVVIKNAQYARDFSPLDPNCDCYTCRNYTRAYIRHLIKCDETFGIRLTSYHNVYFLIKLMEQVRQAIREDRLADFREEFFECYGFNKPNAKNF

tgt

Queuine tRNA-ribosyltransferase

380 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.273 kDa

MTTPIRFELIKTCRQTGARLGILHTPHGSFETPMFMPVGTLATVKTLSPEELKEMGAGVILSNTYHLWLRPGHDIVAEAGGLHAFMNWDRGILTDSGGFQVFSLSEFRRIEEEGVYFRNHLNGDKLFLSPEKATEIQNALGADIIMAFDECPPYPATYDYMKRSVERTSRWAERCLKAHRRSNEQGLFGIVQGGEYEDLRRQSARDLVSLDFPGYAVGGLSVGEPKDVMNRVLEFTTPLLPTDKPRYLMGVGSPDSLIDGAIRGIDMFDCVLPTRIGRNGTVMTSEGRVVIKNAQYARDFTPLDPNCDCYTCRNYTRAYIRHLIKCDETFGIRLTSYHNVYFLIKLMEQVRQAIREDRLADFREEFFERYGFNKPNAKNF

tgt

Queuine tRNA-ribosyltransferase

380 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.418 kDa

MKPAVTYEHIKTCKQSGARLGIVHTPHGSFETPMFMPVGTKATVKTMSPEELHDINAKIILGNTYHLWLQPGNELIKRAGGLHQFMNWDGPILTDSGGFQVFSLSNLRKITEEGVYFRHHKNGSKLFLSPEKSMEIQNDLGSDIMMAFDECPPMPAEYKYVKDSIERTTRWAERCLKAHARPEDQALFGIIQGGEYKDLRQQSAEELVKLDFPGYAIGGLSVGEPKPVMYDMVEHTEQFMPKDKPRYLMGVGSPDALIECSIRGMDMFDCVLPTRIARNGTCMTSEGRVVIKNAKYADDLGPLDPNCDCYTCRNYSRAYLRHLIKAEETFGIRLTTYHNLYFLLKLMEDIRQAIREDRLLDFKEEFFEQYGLNVENPKNF

tgt

Queuine tRNA-ribosyltransferase

380 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.114 kDa

MTDHPIKYRLIKQEKHTGARLGEIITPHGTFPTPMFMPVGTQATVKTQSPEELKEMGSGIILSNTYHLWLRPGDELIAKAGGLHKFMNWDQAILTDSGGFQVYSLADSRNITEEGVTFKNHLNGAKMFLSPEKAISIQNNLGSDIMMSFDECPQFYQPYDYVKKSIERTSRWAERGLNAHRRPHDQGLFGIVQGAGFEDLRRQSARDLVSMDFPGYSIGGLAVGETHDEMNAVLDFTVPMLPNDKPRYLMGVGAPDSLIDAVIRGVDMFDCVLPTRIARNGTCMTSQGRLVVKNAKFAEDFTPLDPNCDCYTCKNYTRAYIRHLLKADETFGIRLTSYHNLYFLVNLMKDVRQAIMDDNLLEFRQDFMERYGYGMNNRNF

tgt

Queuine tRNA-ribosyltransferase

380 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.114 kDa

MTDHPIKYRLIKQEKHTGARLGEIITPHGTFPTPMFMPVGTQATVKTQSPEELKEMGSGIILSNTYHLWLRPGDELIAKAGGLHKFMNWDQAILTDSGGFQVYSLADSRNITEEGVTFKNHLNGAKMFLSPEKAISIQNNLGSDIMMSFDECPQFYQPYDYVKKSIERTSRWAERGLNAHRRPHDQGLFGIVQGAGFEDLRRQSARDLVSMDFPGYSIGGLAVGETHDEMNAVLDFTVPMLPNDKPRYLMGVGAPDSLIDAVIRGVDMFDCVLPTRIARNGTCMTSQGRLVVKNAKFAEDFTPLDPNCDCYTCKNYTRAYIRHLLKADETFGIRLTSYHNLYFLVNLMKDVRQAIMDDNLLEFRQDFMERYGYGMNNRNF

tgt

Queuine tRNA-ribosyltransferase

380 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.114 kDa

MTDHPIKYRLIKQEKHTGARLGEIITPHGTFPTPMFMPVGTQATVKTQSPEELKEMGSGIILSNTYHLWLRPGDELIAKAGGLHKFMNWDQAILTDSGGFQVYSLADSRNITEEGVTFKNHLNGAKMFLSPEKAISIQNNLGSDIMMSFDECPQFYQPYDYVKKSIERTSRWAERGLNAHRRPHDQGLFGIVQGAGFEDLRRQSARDLVSMDFPGYSIGGLAVGETHDEMNAVLDFTVPMLPNDKPRYLMGVGAPDSLIDAVIRGVDMFDCVLPTRIARNGTCMTSQGRLVVKNAKFAEDFTPLDPNCDCYTCKNYTRAYIRHLLKADETFGIRLTSYHNLYFLVNLMKDVRQAIMDDNLLEFRQDFMERYGYGMNNRNF

tgt

Queuine tRNA-ribosyltransferase

380 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.034 kDa

MTNYPITYRLIKKEKHTGARLGEIITPHGTFPTPMFMPVGTQATVKTQSPEELKEIGSGIILSNTYHLWLRPGDELIARAGGLHKFMNWDQAILTDSGGFQVYSLADSRNITEEGVTFKNHLNGSKMFLSPEKAISIQNNLGSDIMMSFDECPQFYQPYDYVKKSIERTSRWAERGLKAHRRPHDQGLFGIVQGAGFEDLRRQSAADLVSMDFPGYSIGGLAVGESHAEMNAVLDFTTPLLPENKPRYLMGVGAPDSLIDGVIRGVDMFDCVLPTRIARNGTCMTSEGRLVVKNAKFAEDFTPLDHHCDCYTCQHYTRAYLRHLLKADETFGMRLTSYHNLYFLVNLMKQVRQAILDDNLLEFRQDFLERYGYNSSSRNF

tgt

Queuine tRNA-ribosyltransferase

380 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.145 kDa

MSDSPIQYRLIKKEKHTGARLGEIITPHGTFPTPMFMPVGTQATVKTQSPEELKQMGSGIILANTYHLWLRPGDELIARAGGLHKFMNWDQPILTDSGGFQVYSLADSRNITEEGVTFKNHLNGSKMFLSPEKAISIQNNLGSDIMMSFDECPQFYQPYDYVKKSIERTSRWAERGLKAHSRPHDQGLFGIVQGAGFEDLRRQSAQDLVSMDFPGYSIGGLAVGESHEEMNAVLDFTTPLLPENKPRYLMGVGAPDSLIDGVIRGVDMFDCVLPTRIARNGTCMTSEGRLVVKNAQFEEDFTPLDHNCDCYTCTNYTRAYIRHLLKADETFGLRLTSYHNLYFLVNLMKKVRQAIMDDNLLEFREDFMERYGYNRSNRNF

tgt

Queuine tRNA-ribosyltransferase

380 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.218 kDa

MTHSPIQYRLIKKEKHTGARLGEIITPHGVFPTPMFMPVGTQATVKTQSPEELKEMKAGIILANTYHLWLRPGDDLVARAGGLHKFMNWDQPILTDSGGFQVYSLAEKRNITEEGVTFKNHLNGARMFLTPEKAISIQNNLGSDIMMSFDECPQFYQPYDYVKASIERTSRWAERGLKAHRRPQDQGLFGIVQGAGFEDLRRQSTADLVSMDFPGYSIGGLAVGESHEEMNAVLDFTTPLLPENKPRYLMGVGAPDSLIDGVIRGVDMFDCVLPTRIARNGTCMTSRGRLVVKNAQYAEDFTPLDHDCDCYTCQNYTRAYIRHLIKADETFGLRLTSYHNLYFLLNLMEKIRQAIMDDNILEFREDFIEKYGYGRSERNF

tgt

Queuine tRNA-ribosyltransferase

380 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.054 kDa

MTDYPIKYRLIKAEKHTGARLGEIITPHGTFPTPMFMPVGTQATVKTQSPEELKAIGSGIILSNTYHLWLRPGDELIARSGGLHKFMNWDQPILTDSGGFQVYSLADSRNITEEGVTFKNHLNGSKMFLSPEKAISIQNNLGSDIMMSFDECPQFYQPYDYVKKSIERTSRWAERGLKAHRRPHDQGLFGIVQGAGFEDLRRQSAADLVAMDFPGYSIGGLAVGESHEEMNAVLDFTTPLLPENKPRYLMGVGAPDSLIDGVIRGVDMFDCVLPTRIARNGTCMTSEGRLVIKNAKFAEDFTPLDHDCDCYTCQNYSRAYIRHLLKADETFGIRLTSYHNLYFLVNLMKKVRQAIMDDNLLEFRQDFLERYGYNKSNRNF

tgt

Queuine tRNA-ribosyltransferase

380 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.121 kDa

MSDSPIKYRLIKKEKHTGARLGEIITPHGTFPTPMFMPVGTQATVKTQSPEELKEMGSGIILSNTYHLWLRPGDELIARAGGLHKFMNWDQPILTDSGGFQVYSLADSRNITEEGVTFKNHLNGSKMFLSPEKAISIQNNLGSDIMMSFDECPQFYQPYDYVKKSIERTSRWAERGLKAHRRPHDQGLFGIVQGAGFEDLRRQSAHDLVSMDFSGYSIGGLAVGETHEEMNAVLDFTTQLLPENKPRYLMGVGAPDSLIDGVIRGVDMFDCVLPTRIARNGTCMTSQGRLVVKNAQFAEDFTPLDPECDCYTCNNYTRAYLRHLLKADETFGIRLTSYHNLYFLLNLMKQVRQAIMDDNLLEFREYFVEKYGYNKSGRNF

tgt

Queuine tRNA-ribosyltransferase

380 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.084 kDa

MTDYPIKYRLIKTEKHTGARLGEIITPHGTFPTPMFMPVGTQATVKTQSPEELKAIGSGIILSNTYHLWLRPGDELIARSGGLHKFMNWDQPILTDSGGFQVYSLADSRNITEEGVTFKNHLNGSKMFLSPEKAISIQNNLGSDIMMSFDECPQFYQPYDYVKKSIERTSRWAERGLKAHRRPHDQGLFGIVQGAGFEDLRRQSAADLVAMDFPGYSIGGLAVGESHEEMNAVLDFTTPLLPENKPRYLMGVGAPDSLIDGVIRGVDMFDCVLPTRIARNGTCMTSEGRLVIKNAKFAEDFTPLDHDCDCYTCQNYSRAYIRHLLKADETFGIRLTSYHNLYFLVNLMKKVRQAIMDDNLLEFRQDFLERYGYNKSNRNF

tgt

Queuine tRNA-ribosyltransferase

380 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.121 kDa

MSDSPIKYRLIKKEKHTGARLGEIITPHGTFPTPMFMPVGTQATVKTQSPEELKEMGSGIILSNTYHLWLRPGDELIARAGGLHKFMNWDQPILTDSGGFQVYSLADSRNITEEGVTFKNHLNGSKMFLSPEKAISIQNNLGSDIMMSFDECPQFYQPYDYVKKSIERTSRWAERGLKAHRRPHDQGLFGIVQGAGFEDLRRQSAHDLVSMDFSGYSIGGLAVGETHEEMNAVLDFTTQLLPENKPRYLMGVGAPDSLIDGVIRGVDMFDCVLPTRIARNGTCMTSQGRLVVKNAQFAEDFTPLDPECDCYTCNNYTRAYLRHLLKADETFGIRLTSYHNLYFLLNLMKQVRQAIMDDNLLEFREYFVEKYGYNKSGRNF

tgt

Queuine tRNA-ribosyltransferase

380 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.1 kDa

MTDYPIKYRLIKTEKHTGARLGEIITPHGTFPTPMFMPVGTQATVKTQSPEELKAIGSGIILSNTYHLWLRPGDELIARSGGLHKFMNWDQPILTDSGGFQVYSLADSRNITEEGVTFKNHLNGSKMFLSPEKAISIQNNLGSDIMMSFDECPQFYQPYDYVKKSIERTSRWAERGLKAHRRPHDQGLFGIVQGAGFEDLRRQSAADLVAMDFLGYSIGGLAVGESHEEMNAVLDFTTPLLPENKPRYLMGVGAPDSLIDGVIRGVDMFDCVLPTRIARNGTCMTSEGRLVIKNAKFAEDFTPLDHDCDCYTCQNYSRAYIRHLLKADETFGIRLTSYHNLYFLVNLMKKVRQAIMDDNLLEFRQDFLERYGYNKSNRNF

tgt

Queuine tRNA-ribosyltransferase

380 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.186 kDa

MTKKRYTLLKKDGKARRGEFVTPHGTIQTPVFMNVGTLAAIKGAVSSMDLKEIGCQVELSNTYHLHLRPGDKIVKQMGGLHNFMNWDRPILTDSGGFQVFSLAGMRKIKEEGVYFNSHIDGRKIFMGPEESMQIQSNLGSTIAMAFDECIPNPSTREYVEKSVARTTRWLERCKKEMDRLNSLDDTVNKEQMLFGINQGGVYEDIRIEHAKTIREMDLDGYAIGGLAVGETHEEMYRVIDAVVPHLPEDKPIYLMGVGLPSNILEAVERGVDFFDCVLPARNGRHGHVFTKEGKINLMNAKFELDARPIDEGCQCPACKNYTRAYIRHLFKAKEMLAMRLCVLHNLYFYNKLMEDIRDAIDGGYFAEFKAKKLEEWNGRA

tgt

Queuine tRNA-ribosyltransferase

380 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.2 kDa

MTKKRYTLLKKDGKARRGEFVTPHGTIQTPIFMNVGTLAAIKGAVSSMDLKEIGCQVELSNTYHLHLRPGDKIVKQMGGLHNFMNWDRPILTDSGGFQVFSLAGMRKIKEEGVYFNSHIDGRKIFMGPEESMQIQSNLGSTIAMAFDECIPNPSTREYVEKSVARTTRWLERCKKEMDRLNSLDDTVNKEQMLFGINQGGVYEDIRIEHAKTIREMDLDGYAIGGLAVGETHEEMYRVIDAVVPHLPEDKPIYLMGVGLPSNILEAVERGVDFFDCVLPARNGRHGHVFTKEGKINLMNAKFELDARPIDEGCQCPACKNYTRAYIRHLFKAKEMLAMRLCVLHNLYFYNKLMEDIRDAIDGGYFAEFKAKKLEEWNGRA

tgt

Queuine tRNA-ribosyltransferase

380 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.186 kDa

MTKKRYTLLKKDGKARRGEFVTPHGTIQTPVFMNVGTLAAIKGAVSSMDLKEIGCQVELSNTYHLHLRPGDKIVKQMGGLHNFMNWDRPILTDSGGFQVFSLAGMRKIKEEGVYFNSHIDGRKIFMGPEESMQIQSNLGSTIAMAFDECIPNPSTREYVEKSVARTTRWLERCKKEMDRLNSLDDTVNKEQMLFGINQGGVYEDIRIEHAKTIREMDLDGYAIGGLAVGETHEEMYRVIDAVVPHLPEDKPIYLMGVGLPSNILEAVERGVDFFDCVLPARNGRHGHVFTKEGKINLMNAKFELDARPIDEGCQCPACKNYTRAYIRHLFKAKEMLAMRLCVLHNLYFYNKLMEDIRDAIDGGYFAEFKAKKLEEWNGRA

tgt

Queuine tRNA-ribosyltransferase

380 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.442 kDa

MKYELDKTDGHARRGRLKFERGVVETPAFMPVGTYGTVKGMTPEEVEATGAQILLGNTFHLWLRPGQEIMKLHGDLHDFMQWKGPILTDSGGFQVFSLGAMRKIKEEGVHFRNPINGEKIFLSPEKSMEIQYDLGSDIVMIFDECTPYPSDWDYAKNSMEMSLRWAKRSRQRFDELNNKNALFGIIQGGVYEDLRDISVKGLVEIGFDGYAVGGLAVGEPKEDMHRILEHVCPQIPADKPRYLMGVGKPEDLVEGVRRGIDMFDCVMPTRNARNGHLFVTNGVIKIRNAKHRSDTSTLDEHCDCYTCKNYSRAYLHHLDRCNEILGARLNTIHNLRYYQRLMAEIRQAIDESRFEDFVHEFYERIGKPVPPLNSSASKCD

tgt

Queuine tRNA-ribosyltransferase

380 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

42.992 kDa

MIDFPIKYRLIKKEKYTGARLGEIITPHGTFPTPMFMPVGTQATVKTQSPEELQQMGSGIILANTYHLWLRPGDELIAKAGGLHKFMNWDQAILTDSGGFQVYSLAEKRDISEEGVTFKNHLNGSKMFLSPEKAISVQNNLGSDIMMSFDECPQFYQPYDYVKKSIERTSRWAERGLKAHRRPHDQGLFGIVQGAGFEDLRRQSSHDLVSMDFPGYSIGGLAVGETHEEMNAVLDFTVPLLPENKPRYLMGVGAPDSLIDGVIRGVDMYDCVLPTRIARNGTCMTSNGRLVVKNAAYAEDFSPIDPECDCYTCKNYTRAYVRHLLKADETFGIRLTSYHNLYFLVNLMAKVRQAIVDDNLLEFRQDFIEKYGYNASNRNF

tgt

Queuine tRNA-ribosyltransferase

380 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

42.992 kDa

MIDFPIKYRLIKKEKYTGARLGEIITPHGTFPTPMFMPVGTQATVKTQSPEELKQMGSGIILANTYHLWLRPGDELIAKAGGLHKFMNWDQAILTDSGGFQVYSLAEKRDISEEGVTFKNHLNGSKMFLSPEKAISVQNNLGSDIMMSFDECPQFYQPYDYVKKSIERTSRWAERGLKAHRRPHDQGLFGIVQGAGFEDLRRQSSHDLVSMDFPGYSIGGLAVGETHEEMNAVLDFTVPLLPENKPRYLMGVGAPDSLIDGVIRGVDMYDCVLPTRIARNGTCMTSNGRLVVKNAAYAEDFSPIDPECDCYTCKNYTRAYVRHLLKADETFGIRLTSYHNLYFLVNLMAKVRQAIVDDNLLEFRQDFIEKYGYNASNRNF

tgt

Queuine tRNA-ribosyltransferase

380 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.075 kDa

MTDYPIKYRLIKKEKHTGARLGEIITPHGTFPTPMFMPVGTQATVKTQSPEELKAMGSGIILSNTYHLWLRPGDELIAKAGGLHKFMNWDQPILTDSGGFQVYSLADSRNITEEGVTFKNHLNGSKMFLSPEKAISIQNNLGSDIMMSFDECPQFYQPYDYVKKSIERTSRWAERGLKAHRRPHDQGLFGIVQGAGFEDLRRQSAADLVSMDFPGYSVGGLAVGESHEEMNAVLDFTTPLLPENKPRYLMGVGAPDSLIDGVIRGIDMFDCVLPTRIARNGTCMTSEGRLVVKNAKFAEDFTPLDHDCDCYTCQNYTRAYIRHLLKADETFGIRLTSYHNLYFLVNLMKKVRQAIMDDNLLEFREDFLERYGYNTSNRNF

tgt

Queuine tRNA-ribosyltransferase

380 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.121 kDa

MSDSPIKYRLIKKEKHTGARLGEIITPHGTFPTPMFMPVGTQATVKTQSPEELKEMGSGIILSNTYHLWLRPGDELIARAGGLHKFMNWDQPILTDSGGFQVYSLADSRNITEEGVTFKNHLNGSKMFLSPEKAISIQNNLGSDIMMSFDECPQFYQPYDYVKKSIERTSRWAERGLKAHRRPHDQGLFGIVQGAGFEDLRRQSAHDLVSMDFSGYSIGGLAVGETHEEMNAVLDFTTQLLPENKPRYLMGVGAPDSLIDGVIRGVDMFDCVLPTRIARNGTCMTSQGRLVVKNAQFAEDFTPLDPECDCYTCNNYTRAYLRHLLKADETFGIRLTSYHNLYFLLNLMKQVRQAIMDDNLLEFREYFVEKYGYNKSGRNF

tgt

Queuine tRNA-ribosyltransferase

380 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.086 kDa

MSDSPIKYRLIKKEKHTGARLGEIITPHGTFPTPMFMPVGTQATVKTQSPEELKEMGSGIILSNTYHLWLRPGDELIARAGGLHKFMNWDQPILTDSGGFQVYSLADSRNITEEGVTFKNHLNGSKMLLSPEKAISIQNNLGSDIMMSFDECPQFYQPYDYVKKSIERTSRWAERGLKAHRRPHDQGLFGIVQGAGFEDLRRQSAHDLVSMDFSGYSIGGLAVGETHEEMNAVLDFTTQLLPENKPRYLMGVGAPDSLIDGVIRGVDMFDCVLPTRIARNGTCMTSQGRLVVKNAQFAEDFTPLDPECDCYTCNNYTRAYLRHLLKADETFGIRLTSYHNLYFLLNLMKQVRQAIMDDNLLEFRKYFVEKYGYNKSGRNF

tgt

Queuine tRNA-ribosyltransferase

380 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.12 kDa

MSDSPIKYRLIKKEKHTGARLGEIITPHGTFPTPMFMPVGTQATVKTQSPEELKEMGSGIILSNTYHLWLRPGDELIARAGGLHKFMNWDQPILTDSGGFQVYSLADSRNITEEGVTFKNHLNGSKMFLSPEKAISIQNNLGSDIMMSFDECPQFYQPYDYVKKSIERTSRWAERGLKAHRRPHDQGLFGIVQGAGFEDLRRQSAHDLVSMDFSGYSIGGLAVGETHEEMNAVLDFTTQLLPENKPRYLMGVGAPDSLIDGVIRGVDMFDCVLPTRIARNGTCMTSQGRLVVKNAQFAEDFTPLDPECDCYTCNNYTRAYLRHLLKADETFGIRLTSYHNLYFLLNLMKQVRQAIMDDNLLEFRKYFVEKYGYNKSGRNF

tgt

Queuine tRNA-ribosyltransferase

380 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

42.83 kDa

MEPAIKYRLIKKEKHTGARLGELITPHGTFPTPMFMPVGTQASVKSLAPEELDAMGAGVILSNTYHLWLRPGEQIVKEAGGLHQFMNWKKGILTDSGGFQVFSLAKNRDITEEGVHFKNHLNGSKMFLSPEKAIQIENDLGPDIMMSLDECPPFFESYDYVSKSVARTSRWAERGLKVHQHPDYQGLFGIVQGAGFKDLREQSAKDLVSLDFPGYSIGGLSVGESKAEMNHVLDFTTPLLPENKPRYLMGVGSADALIDGAIRGVDMFDCVLPTRIARNGTCMTSHGRLVVKNAAYAHDFTPLDDNCDCYTCRNFTRAYIRHLIKADETFGLRLTSYHNLYFLLHLMKQVRQAIMDDNLLEFRQNFFEMYGFNDKNPKNF

tgt

Queuine tRNA-ribosyltransferase

380 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

42.85 kDa

MEPAIKYRLIKKEKHTGARLGEIVTPHGTFKTPMFMPVGTQASVKTMAPEDLKEMGAGIILSNTYHLWLRPGEDIVEKAGGLHKFMNWDRGVLTDSGGFQVFSLAKLRDISEEGVAFKSHLNGEKLFLSPEKAIHVENALGADIMMSFDECPPFFESYDYVKKSVERTSRWAERGLIAHQNPATQGLFGIVQGAGFEDLRRQSARDLVGMDFPGYSIGGLSVGESKGEMNRVLDFTTPMLPEDKPRYLMGVGSPDALIDGVIRGVDMFDCVLPTRIARNGTTMTSQGRLVVKNAKYSEDFRPLDPKCDCYVCKNYTRAYIRHLIKADETFGIHLTSYHNLYFLINLMHQVQDAIEQDNLLEFREAFFEEYGYNENNGRNF

tgt

Queuine tRNA-ribosyltransferase

380 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.12 kDa

MSDSPIKYRLIKKEKHTGARLGEIITPHGTFPTPMFMPVGTQATVKTQSPEELKEMGSGIILSNTYHLWLRPGDELIARAGGLHKFMNWDQPILTDSGGFQVYSLADSRNITEEGVTFKNHLNGSKMFLSPEKAISIQNNLGSDIMMSFDECPQFYQPYDYVKKSIERTSRWAERGLKAHRRPHDQGLFGIVQGAGFEDLRRQSAHDLVSMDFSGYSIGGLAVGETHEEMNAVLDFTTQLLPENKPRYLMGVGAPDSLIDGVIRGVDMFDCVLPTRIARNGTCMTSQGRLVVKNAQFAEDFTPLDPECDCYTCNNYTRAYLRHLLKADETFGIRLTSYHNLYFLLNLMKQVRQAIMDDNLLEFRKYFVEKYGYNKSGRNF

tgt

Queuine tRNA-ribosyltransferase

380 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.084 kDa

MTDYPIKYRLIKTEKHTGARLGEIITPHGTFPTPMFMPVGTQATVKTQSPEELKAIGSGIILSNTYHLWLRPGDELIARSGGLHKFMNWDQPILTDSGGFQVYSLADSRNITEEGVTFKNHLNGSKMFLSPEKAISIQNNLGSDIMMSFDECPQFYQPYDYVKKSIERTSRWAERGLKAHRRPHDQGLFGIVQGAGFEDLRRQSAADLVAMDFPGYSIGGLAVGESHEEMNAVLDFTTPLLPENKPRYLMGVGAPDSLIDGVIRGVDMFDCVLPTRIARNGTCMTSEGRLVIKNAKFAEDFTPLDHDCDCYTCQNYSRAYIRHLLKADETFGIRLTSYHNLYFLVNLMKKVRQAIMDDNLLEFRQDFLERYGYNKSNRNF

tgt

Queuine tRNA-ribosyltransferase

380 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.084 kDa

MTDYPIKYRLIKTEKHTGARLGEIITPHGTFPTPMFMPVGTQATVKTQSPEELKAIGSGIILSNTYHLWLRPGDELIARSGGLHKFMNWDQPILTDSGGFQVYSLADSRNITEEGVTFKNHLNGSKMFLSPEKAISIQNNLGSDIMMSFDECPQFYQPYDYVKKSIERTSRWAERGLKAHRRPHDQGLFGIVQGAGFEDLRRQSAADLVAMDFPGYSIGGLAVGESHEEMNAVLDFTTPLLPENKPRYLMGVGAPDSLIDGVIRGVDMFDCVLPTRIARNGTCMTSEGRLVIKNAKFAEDFTPLDHDCDCYTCQNYSRAYIRHLLKADETFGIRLTSYHNLYFLVNLMKKVRQAIMDDNLLEFRQDFLERYGYNKSNRNF

tgt

Queuine tRNA-ribosyltransferase

380 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.084 kDa

MTDYPIKYRLIKTEKHTGARLGEIITPHGTFPTPMFMPVGTQATVKTQSPEELKAIGSGIILSNTYHLWLRPGDELIARSGGLHKFMNWDQPILTDSGGFQVYSLADSRNITEEGVTFKNHLNGSKMFLSPEKAISIQNNLGSDIMMSFDECPQFYQPYDYVKKSIERTSRWAERGLKAHRRPHDQGLFGIVQGAGFEDLRRQSAADLVAMDFPGYSIGGLAVGESHEEMNAVLDFTTPLLPENKPRYLMGVGAPDSLIDGVIRGVDMFDCVLPTRIARNGTCMTSEGRLVIKNAKFAEDFTPLDHDCDCYTCQNYSRAYIRHLLKADETFGIRLTSYHNLYFLVNLMKKVRQAIMDDNLLEFRQDFLERYGYNKSNRNF

tgt

Queuine tRNA-ribosyltransferase

380 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.084 kDa

MTDYPIKYRLIKTEKHTGARLGEIITPHGTFPTPMFMPVGTQATVKTQSPEELKAIGSGIILSNTYHLWLRPGDELIARSGGLHKFMNWDQPILTDSGGFQVYSLADSRNITEEGVTFKNHLNGSKMFLSPEKAISIQNNLGSDIMMSFDECPQFYQPYDYVKKSIERTSRWAERGLKAHRRPHDQGLFGIVQGAGFEDLRRQSAADLVAMDFPGYSIGGLAVGESHEEMNAVLDFTTPLLPENKPRYLMGVGAPDSLIDGVIRGVDMFDCVLPTRIARNGTCMTSEGRLVIKNAKFAEDFTPLDHDCDCYTCQNYSRAYIRHLLKADETFGIRLTSYHNLYFLVNLMKKVRQAIMDDNLLEFRQDFLERYGYNKSNRNF

tgt

Queuine tRNA-ribosyltransferase

380 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.07 kDa

MTDYPIKYRLIKTEKHTGARLGEIITPHGTFPTPMFMPVGTQATVKTQSPEELKAIGSGIILSNTYHLWLRPGDELIARSGGLHKFMNWDQPILTDSGGFQVYSLADSRNITEEGVTFKNHLNGSKMFLSPEKAISIQNNLGSDIMMSFDECPQFYQPYDYVKKSIERTSRWAERGLKAHRRPHDQGLFGIVQGAGFEDLRRQSAADLVAMDFPGYSIGGLAVGESHEEMNAVLDFTTPLLPENKPRYLMGVGAPDSLIDGVIRGVDMFDCVLPTRIARNGTCMTSEGRLVVKNAKFAEDFTPLDHDCDCYTCQNYSRAYIRHLLKADETFGIRLTSYHNLYFLVNLMKKVRQAIMDDNLLEFRQDFLERYGYNKSNRNF

tgt

Queuine tRNA-ribosyltransferase

380 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.084 kDa

MTDYPIKYRLIKTEKHTGARLGEIITPHGTFPTPMFMPVGTQATVKTQSPEELKAIGSGIILSNTYHLWLRPGDELIARSGGLHKFMNWDQPILTDSGGFQVYSLADSRNITEEGVTFKNHLNGSKMFLSPEKAISIQNNLGSDIMMSFDECPQFYQPYDYVKKSIERTSRWAERGLKAHRRPHDQGLFGIVQGAGFEDLRRQSAADLVAMDFPGYSIGGLAVGESHEEMNAVLDFTTPLLPENKPRYLMGVGAPDSLIDGVIRGVDMFDCVLPTRIARNGTCMTSEGRLVIKNAKFAEDFTPLDHDCDCYTCQNYSRAYIRHLLKADETFGIRLTSYHNLYFLVNLMKKVRQAIMDDNLLEFRQDFLERYGYNKSNRNF

tgt

Queuine tRNA-ribosyltransferase

380 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.145 kDa

MSDSPIKYRLIKKEKHTGARLGEIITPHGTFPTPMFMPVGTQATVKTQSPEELKEMGSGIILSNTYHLWLRPGDELIARAGGLHKFMNWDQPILTDSGGFQVYSLADSRNITEEGVTFKNHLNGSKMFLSPEKAISIQNNLGSDIMMSFDECPQFYQPYDYVKKSIERTSRWAERGLKAHRRPHDQGLFGIVQGAGFEDLRRQSAHDLVSMDFPGYSIGGLAVGETHEEMNAVLDFTTQLLPENKPRYLMGVGAPDSLIDGVIRGVDMFDCVLPTRIARNGTCMTSQGRLVVKNAQFAEDFTPLDPECDCYTCKNYTRAYLRHLLKADETFGIRLTSYHNLYFLLNLMKQVRQAIMDDNLLEFREYFVEKYGYNKSGRNF

tgt

Queuine tRNA-ribosyltransferase

380 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.121 kDa

MSDSPIKYRLIKKEKHTGARLGEIITPHGTFPTPMFMPVGTQATVKTQSPEELKEMGSGIILSNTYHLWLRPGDELIARAGGLHKFMNWDQPILTDSGGFQVYSLADSRNITEEGVTFKNHLNGSKMFLSPEKAISIQNNLGSDIMMSFDECPQFYQPYDYVKKSIERTSRWAERGLKAHRRPHDQGLFGIVQGAGFEDLRRQSAHDLVSMDFSGYSIGGLAVGETHEEMNAVLDFTTQLLPENKPRYLMGVGAPDSLIDGVIRGVDMFDCVLPTRIARNGTCMTSQGRLVVKNAQFAEDFTPLDPECDCYTCNNYTRAYLRHLLKADETFGIRLTSYHNLYFLLNLMKQVRQAIMDDNLLEFREYFVEKYGYNKSGRNF

tgt

Queuine tRNA-ribosyltransferase

380 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.084 kDa

MTDYPIKYRLIKTEKHTGARLGEIITPHGTFPTPMFMPVGTQATVKTQSPEELKAIGSGIILSNTYHLWLRPGDELIARSGGLHKFMNWDQPILTDSGGFQVYSLADSRNITEEGVTFKNHLNGSKMFLSPEKAISIQNNLGSDIMMSFDECPQFYQPYDYVKKSIERTSRWAERGLKAHRRPHDQGLFGIVQGAGFEDLRRQSAADLVAMDFPGYSIGGLAVGESHEEMNAVLDFTTPLLPENKPRYLMGVGAPDSLIDGVIRGVDMFDCVLPTRIARNGTCMTSEGRLVIKNAKFAEDFTPLDHDCDCYTCQNYSRAYIRHLLKADETFGIRLTSYHNLYFLVNLMKKVRQAIMDDNLLEFRQDFLERYGYNKSNRNF

tgt

Queuine tRNA-ribosyltransferase

380 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.121 kDa

MSDSPIKYRLIKKEKHTGARLGEIITPHGTFPTPMFMPVGTQATVKTQSPEELKEMGSGIILSNTYHLWLRPGDELIARAGGLHKFMNWDQPILTDSGGFQVYSLADSRNITEEGVTFKNHLNGSKMFLSPEKAISIQNNLGSDIMMSFDECPQFYQPYDYVKKSIERTSRWAERGLKAHRRPHDQGLFGIVQGAGFEDLRRQSAHDLVSMDFSGYSIGGLAVGETHEEMNAVLDFTTQLLPENKPRYLMGVGAPDSLIDGVIRGVDMFDCVLPTRIARNGTCMTSQGRLVVKNAQFAEDFTPLDPECDCYTCNNYTRAYLRHLLKADETFGIRLTSYHNLYFLLNLMKQVRQAIMDDNLLEFREYFVEKYGYNKSGRNF

tgt

Queuine tRNA-ribosyltransferase

380 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.084 kDa

MTDYPIKYRLIKTEKHTGARLGEIITPHGTFPTPMFMPVGTQATVKTQSPEELKAIGSGIILSNTYHLWLRPGDELIARSGGLHKFMNWDQPILTDSGGFQVYSLADSRNITEEGVTFKNHLNGSKMFLSPEKAISIQNNLGSDIMMSFDECPQFYQPYDYVKKSIERTSRWAERGLKAHRRPHDQGLFGIVQGAGFEDLRRQSAADLVAMDFPGYSIGGLAVGESHEEMNAVLDFTTPLLPENKPRYLMGVGAPDSLIDGVIRGVDMFDCVLPTRIARNGTCMTSEGRLVIKNAKFAEDFTPLDHDCDCYTCQNYSRAYIRHLLKADETFGIRLTSYHNLYFLVNLMKKVRQAIMDDNLLEFRQDFLERYGYNKSNRNF

tgt

Queuine tRNA-ribosyltransferase

380 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.121 kDa

MSDSPIKYRLIKKEKHTGARLGEIITPHGTFPTPMFMPVGTQATVKTQSPEELKEMGSGIILSNTYHLWLRPGDELIARAGGLHKFMNWDQPILTDSGGFQVYSLADSRNITEEGVTFKNHLNGSKMFLSPEKAISIQNNLGSDIMMSFDECPQFYQPYDYVKKSIERTSRWAERGLKAHRRPHDQGLFGIVQGAGFEDLRRQSAHDLVSMDFSGYSIGGLAVGETHEEMNAVLDFTTQLLPENKPRYLMGVGAPDSLIDGVIRGVDMFDCVLPTRIARNGTCMTSQGRLVVKNAQFAEDFTPLDPECDCYTCNNYTRAYLRHLLKADETFGIRLTSYHNLYFLLNLMKQVRQAIMDDNLLEFREYFVEKYGYNKSGRNF

tgt

Queuine tRNA-ribosyltransferase

380 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.07 kDa

MTDYPIKYRLIKTEKHTGARLGEIITPHGTFPTPMFMPVGTQATVKTQSPEELKAIGSGIILSNTYHLWLRPGDELIARSGGLHKFMNWDQPILTDSGGFQVYSLADSRNITEEGVTFKNHLNGSKMFLSPEKAISIQNNLGSDIMMSFDECPQFYQPYDYVKKSIERTSRWAERGLKAHRRPHDQGLFGIVQGAGFEDLRRQSAADLVAMDFPGYSIGGLAVGESHEEMNAVLDFTTPLLPENKPRYLMGVGAPDSLIDGVIRGVDMFDCVLPTRIARNGTCMTSEGRLVVKNAKFAEDFTPLDHDCDCYTCQNYSRAYIRHLLKADETFGIRLTSYHNLYFLVNLMKKVRQAIMDDNLLEFRQDFLERYGYNKSNRNF

tgt

Queuine tRNA-ribosyltransferase

380 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.121 kDa

MSDSPIKYRLIKKEKHTGARLGEIITPHGTFPTPMFMPVGTQATVKTQSPEELKEMGSGIILSNTYHLWLRPGDELIARAGGLHKFMNWDQPILTDSGGFQVYSLADSRNITEEGVTFKNHLNGSKMFLSPEKAISIQNNLGSDIMMSFDECPQFYQPYDYVKKSIERTSRWAERGLKAHRRPHDQGLFGIVQGAGFEDLRRQSAHDLVSMDFSGYSIGGLAVGETHEEMNAVLDFTTQLLPENKPRYLMGVGAPDSLIDGVIRGVDMFDCVLPTRIARNGTCMTSQGRLVVKNAQFAEDFTPLDPECDCYTCNNYTRAYLRHLLKADETFGIRLTSYHNLYFLLNLMKQVRQAIMDDNLLEFREYFVEKYGYNKSGRNF

tgt

Queuine tRNA-ribosyltransferase

380 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.037 kDa

MTDVPIKYRLIKKEKHTGARLGEIITPHGTFPTPMFMPVGTQATVKTMSPEELKAMGSGIILSNTYHLWLRPGDELVARAGGLHKFMNWDQPILTDSGGFQVYSLADSRNISEEGVTFKNHLNGSKMFLSPEKAISIQNNLGSDIMMSFDECPQFYQPYDYVKKSIERTSRWAERGLKAHRRPHDQGLFGIVQGAGFEDLRRQSAHDLVSMDFPGYSIGGLAVGETHDEMNAVLDFTTPLLPENKPRYLMGVGAPDSLIDGVIRGVDMFDCVLPTRIARNGTCMTNRGRLVVKNAQFAEDFTPLDPECDCYTCKNYTRAYLRHLLKADETFGIRLTSYHNLYFLINLMKNVRQAIMDDNLLEFRQDFMEKYGYGKNGRNF

tgt

Queuine tRNA-ribosyltransferase

380 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

42.999 kDa

MTNYPITYRLIKKEKHTGARLGEIITPHGTFPTPMFMPVGTQATVKTQSPEELKEIGSGIILSNTYHLWLRPGDELIARAGGLHKFMNWDQAILTDSGGFQVYSLADSRNITEEGVTFKNHLNGSKMFLSPEKAISIQNNLGSDIMMSFDECPQFYQPYDYVKKSIERTSRWAERGLKAHRRPHDQGLFGIVQGAGFEDLRRQSAADLVGMDFPGYSIGGLAVGESHAEMNAVLDFTTPLLPENKPRYLMGVGAPDSLIDGVIRGVDMFDCVLPTRIARNGTCMTSEGRLVVKNAKFAEDFTPLDHNCDCYTCQHYTRAYLRHLLKADETFGMRLTSYHNLYFLVNLMKQVRQAIMDDNLLEFRQDFLERYGYNSSSRNF

tgt

Queuine tRNA-ribosyltransferase

380 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.036 kDa

MSTSPIQYRLIKKEKHTGARLGEIITPHGTFPTPMFMPVGTQATVKTQSPEELKQMGSGIILANTYHLWLRPGDELIARAGGLHTFMNWDQPILTDSGGFQVYSLADSRNITEEGVTFKNHLNGSKMFLSPEKAISIQNNLGSDIMMSFDECPQFYQPYDYVKKSIERTSRWAERGLKAHSRPHDQGLFGIVQGAGFEDLRRQSAQDLVSMDFPGYSIGGLAVGESHEEMNAVLDFTTPMLPENKPRYLMGVGAPDSLIDGVIRGVDMFDCVLPTRIARNGTCMTSEGRLVVKNAQFEEDFTPLDHDCDCYTCSNYTRAYIRHLLKADETFGIRLTSYHNLYFLVNLMKKVRQAIMDDNLLEFREDFIERYGYNKSSRNF

tgt

Queuine tRNA-ribosyltransferase

380 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.037 kDa

MTDVPIKYRLIKKEKHTGARLGEIITPHGTFPTPMFMPVGTQATVKTMSPEELKAMGSGIILSNTYHLWLRPGDELVARAGGLHKFMNWDQPILTDSGGFQVYSLADSRNISEEGVTFKNHLNGSKMFLSPEKAISIQNNLGSDIMMSFDECPQFYQPYDYVKKSIERTSRWAERGLKAHRRPHDQGLFGIVQGAGFEDLRRQSAHDLVSMDFPGYSIGGLAVGETHDEMNAVLDFTTPLLPENKPRYLMGVGAPDSLIDGVIRGVDMFDCVLPTRIARNGTCMTNRGRLVVKNAQFAEDFTPLDPECDCYTCKNYTRAYLRHLLKADETFGIRLTSYHNLYFLINLMKNVRQAIMDDNLLEFRQDFMEKYGYGKNGRNF

tgt

Queuine tRNA-ribosyltransferase

380 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.02 kDa

MIDFPIKYRLIKKEKYTGARLGEIITPHGTFPTPMFMPVGTQATVKTQSPEELQQMGSGIILANTYHLWLRPGDELIAKAGGLHKFMNWDQAILTDSGGFQVYSLAEKRDISEEGVTFKNHLNGSKMFLSPEKAISVQNNLGSDIMMSFDECPQFYQPYDYVKKSIERTSRWAERGLKAHRRPHDQGLFGIVQGAGFEDLRRQSSHDLVSMDFPGYSIGGLAVGETHEEMNAVLDFTVPLLPENKPRYLMGVGAPDSLIDGVIRGVDMYDCVLPTRIARNGTCMTSNGRLVVKNAAYAEDFSPIDPECDCYTCKNYTRAYVRHLLKADETFGIRLTSYHNLYFLVNLMARVRQAIVDDNLLEFRQDFIEKYGYNASNRNF

tgt

Queuine tRNA-ribosyltransferase

379 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

42.915 kDa

MNPITYELIKTDKQTGARLGRVHTPHGSFDTPTFMPVGTLATVKTMSPEDLQSMQANIILSNTYHLWLRPGEDIIREAGGLHKFMNWDGAILTDSGGFQVFSLSDMREIKEEGVHFRNHLNGEKLFLSPEKAMDIQNALGSDIMMAFDECPPYPAEYDYMKASVERTSRWAERCLQAHNRPHDQGLFGIVQGGEYEALRKQSAEDLVSLDFPGYAIGGLSVGEPKHVMNKVLEFTTPFLPSNKPRYLMGVGSPDALIDGAIRGVDMFDCVLPTRIARNGTCMTSNGRLVVRNAKYARDFNPIDEHCSCHVCKNYSRAYIRHLIKCNETFGFRLTTYHNLHFLLKLMEQVRTAIKEDRLGDFKESFFEQYGLNKANPKNF

tgt

Queuine tRNA-ribosyltransferase

379 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.385 kDa

MKFKLKTTSGTARRGEMTFSRPQGEFTVQTPAFMPVGTYGTVKGMTPEEVRATGAEILLGNTFHLWLRPGQEVMRKHGDLHDFMQWHRPILTDSGGFQVFSLGKLRKITEEGVKFQNPINGERIFLSPEKSMEIQYDLGSDIVMIFDECTPYPATFDYAKKSMEMSLRWAQRSRDRFDELGNKNALFGIVQGGTFEELRKVSAEGLVDIGFDGYAVGGLAVGEPKEEMHRILEFTTPLLPADKPRYLMGVGKPEDLVEGVRRGIDMFDCVMPTRNARNGHLFVTDGIVKIRNAKYRDDTSALDPHCDCYTCRHYTKSYLYHLDKCGEILGARLNTIHNLRYYQRLMEEIRQAIEEDRFDDFVVEFYTRMGKEVPPLQKP

tgt

Queuine tRNA-ribosyltransferase

379 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.161 kDa

MTPIRYELIKTCKQTGARLGILHTPHGSFETPMFMPVGTLATVKTLSPEELKEMGAGVILSNTYHLWLRPGHDIVKEAGGLHSFMNWDRGILTDSGGFQVFSLSEFRRIEEEGVYFRNHLNGDQLFLSPEKAMEIQNALGSDIMMAFDECPPYPATYEYMKRSVERTSRWAERCLKAHQRPNEQGLFGIVQGGEFEDLRKQSAQDLVSLDFPGYAVGGLSVGEPKEVMNRVLEFTTPLLPANKPRYLMGVGSPDSLIDGAIRGIDMFDCVLPTRIGRNGTVMTSEGRVVIKNAKYARDFTPLDPNCDCYTCRNYTRAYIRHLIKCDETFGIRLTSYHNVYFLIKLMEQVRQAIREDRLGDFREQFFEQYGFNKPNAKNF

tgt

Queuine tRNA-ribosyltransferase

379 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

42.674 kDa

MPQISFEVVAECPHTRARAGVLHTAHGDIETPVFMPVGTQATVKGLTQRDLAEDLGVKILLSNTYHLYLRPGHELIRQMGGLHKFMSWPNAILTDSGGFQVFSLSGLRKIHEHGVVFQSHLNGDTHKFTPESTVDVQLAYGSDILMVLDECPEYPVSHEYARESMQRTVRWAREANEHFLERMKQMPTRHALFPIVQGSMFTDLRRECATALVDLDTDGYAIGGLSVGEPRPLSLEVVEATEAILPRTKPRYAMGVGMPAELPEYVARGIDMMDCVLPSRNARNGYLFTSEGRVIIKHARYKDDEGPLDPRCACYTCKSYSRAYLRHLFQSGEILFSVLATRHNIQRYLDIMREIRHAIISGSFPDYLRCVQSSLHDAG

tgt

Queuine tRNA-ribosyltransferase

379 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.31 kDa

MPAVTYEHIKTCKQSGARLGIVHTPHGSFETPMFMPVGTKATVKTMSPEELRQIEAKIILGNTYHLWLQPGNDIIKHAGGLHKFMNWDGPILTDSGGFQVFSLSNLRKITEEGVEFRHHTNGSKLFLSPEKSMQIQNDLGSDIMMAFDECPPMPAEYDYVKKSIERTTRWAKRCLDAHQRPEDQALFGIIQGGEYEDLREQSAKDLVELDFPGYAIGGLSVGEPKPVMYKMVEHTEQFMPKDKPRYLMGVGSPDALIECSIRGMDMFDCVLPTRIARNGTCMTSQGRLVIKNAKFADDLRPLDENCDCYTCQNYSRAYIRHLIKAEETFGIRLTTIHNLHFLLKLMEDIRQAIREDRLLDFKEEFFEQYGLNVENPKNF

tgt

Queuine tRNA-ribosyltransferase

379 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.31 kDa

MPAVTYEHIKTCKQSGARLGIVHTPHGSFETPMFMPVGTKATVKTMSPEELRQIEAKIILGNTYHLWLQPGNDIIKHAGGLHKFMNWDGPILTDSGGFQVFSLSNLRKITEEGVEFRHHTNGSKLFLSPEKSMQIQNDLGSDIMMAFDECPPMPAEYDYVKKSIERTTRWAKRCLDAHQRPEDQALFGIIQGGEYEDLREQSAKDLVELDFPGYAIGGLSVGEPKPVMYKMVEHTEQFMPKDKPRYLMGVGSPDALIECSIRGMDMFDCVLPTRIARNGTCMTSQGRLVIKNAKFADDLRPLDENCDCYTCQNYSRAYIRHLIKAEETFGIRLTTIHNLHFLLKLMEDIRQAIREDRLLDFKEEFFEQYGLNVENPKNF

tgt

Queuine tRNA-ribosyltransferase

379 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.31 kDa

MPAVTYEHIKTCKQSGARLGIVHTPHGSFETPMFMPVGTKATVKTMSPEELRQIEAKIILGNTYHLWLQPGNDIIKHAGGLHKFMNWDGPILTDSGGFQVFSLSNLRKITEEGVEFRHHTNGSKLFLSPEKSMQIQNDLGSDIMMAFDECPPMPAEYDYVKKSIERTTRWAKRCLDAHQRPEDQALFGIIQGGEYEDLREQSAKDLVELDFPGYAIGGLSVGEPKPVMYKMVEHTEQFMPKDKPRYLMGVGSPDALIECSIRGMDMFDCVLPTRIARNGTCMTSQGRLVIKNAKFADDLRPLDENCDCYTCQNYSRAYIRHLIKAEETFGIRLTTIHNLHFLLKLMEDIRQAIREDRLLDFKEEFFEQYGLNVENPKNF

tgt

Queuine tRNA-ribosyltransferase

379 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.31 kDa

MPAVTYEHIKTCKQSGARLGIVHTPHGSFETPMFMPVGTKATVKTMSPEELRQIEAKIILGNTYHLWLQPGNDIIKHAGGLHKFMNWDGPILTDSGGFQVFSLSNLRKITEEGVEFRHHTNGSKLFLSPEKSMQIQNDLGSDIMMAFDECPPMPAEYDYVKKSIERTTRWAKRCLDAHQRPEDQALFGIIQGGEYEDLREQSAKDLVELDFPGYAIGGLSVGEPKPVMYKMVEHTEQFMPKDKPRYLMGVGSPDALIECSIRGMDMFDCVLPTRIARNGTCMTSQGRLVIKNAKFADDLRPLDENCDCYTCQNYSRAYIRHLIKAEETFGIRLTTIHNLHFLLKLMEDIRQAIREDRLLDFKEEFFEQYGLNVENPKNF

tgt

Queuine tRNA-ribosyltransferase

379 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.31 kDa

MPAVTYEHIKTCKQSGARLGIVHTPHGSFETPMFMPVGTKATVKTMSPEELRQIEAKIILGNTYHLWLQPGNDIIKHAGGLHKFMNWDGPILTDSGGFQVFSLSNLRKITEEGVEFRHHTNGSKLFLSPEKSMQIQNDLGSDIMMAFDECPPMPAEYDYVKKSIERTTRWAKRCLDAHQRPEDQALFGIIQGGEYEDLREQSAKDLVELDFPGYAIGGLSVGEPKPVMYKMVEHTEQFMPKDKPRYLMGVGSPDALIECSIRGMDMFDCVLPTRIARNGTCMTSQGRLVIKNAKFADDLRPLDENCDCYTCQNYSRAYIRHLIKAEETFGIRLTTIHNLHFLLKLMEDIRQAIREDRLLDFKEEFFEQYGLNVENPKNF

tgt

Queuine tRNA-ribosyltransferase

379 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.284 kDa

MPAVTYEHIKTCKQSGARLGIVHTPHGSFETPMFMPVGTKATVKTMSPEELRQIEAKIILGNTYHLWLQPGNDIIKHAGGLHKFMNWDGPILTDSGGFQVFSLSNLRKITEEGVEFRHHTNGSKLFLSPEKSMQIQNDLGSDIMMAFDECPPMPAEYDYVKKSIERTTRWAKRCLDAHQRPEDQALFGIIQGGEHEDLREQSAKDLVELDFPGYAIGGLSVGEPKPVMYKMVEHTEQFMPKDKPRYLMGVGSPDALIECSIRGMDMFDCVLPTRIARNGTCMTSQGRLVIKNAKFADDLRPLDENCDCYTCQNYSRAYIRHLIKAEETFGIRLTTIHNLHFLLKLMEDIRQAIREDRLLDFKEEFFEQYGLNVENPKNF

tgt

Queuine tRNA-ribosyltransferase

379 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.31 kDa

MPAVTYEHIKTCKQSGARLGIVHTPHGSFETPMFMPVGTKATVKTMSPEELRQIEAKIILGNTYHLWLQPGNDIIKHAGGLHKFMNWDGPILTDSGGFQVFSLSNLRKITEEGVEFRHHTNGSKLFLSPEKSMQIQNDLGSDIMMAFDECPPMPAEYDYVKKSIERTTRWAKRCLDAHQRPEDQALFGIIQGGEYEDLREQSAKDLVELDFPGYAIGGLSVGEPKPVMYKMVEHTEQFMPKDKPRYLMGVGSPDALIECSIRGMDMFDCVLPTRIARNGTCMTSQGRLVIKNAKFADDLRPLDENCDCYTCQNYSRAYIRHLIKAEETFGIRLTTIHNLHFLLKLMEDIRQAIREDRLLDFKEEFFEQYGLNVENPKNF

tgt

Queuine tRNA-ribosyltransferase

379 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.31 kDa

MPAVTYEHIKTCKQSGARLGIVHTPHGSFETPMFMPVGTKATVKTMSPEELRQIEAKIILGNTYHLWLQPGNDIIKHAGGLHKFMNWDGPILTDSGGFQVFSLSNLRKITEEGVEFRHHTNGSKLFLSPEKSMQIQNDLGSDIMMAFDECPPMPAEYDYVKKSIERTTRWAKRCLDAHQRPEDQALFGIIQGGEYEDLREQSAKDLVELDFPGYAIGGLSVGEPKPVMYKMVEHTEQFMPKDKPRYLMGVGSPDALIECSIRGMDMFDCVLPTRIARNGTCMTSQGRLVIKNAKFADDLRPLDENCDCYTCQNYSRAYIRHLIKAEETFGIRLTTIHNLHFLLKLMEDIRQAIREDRLLDFKEEFFEQYGLNVENPKNF

tgt

Queuine tRNA-ribosyltransferase

379 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.31 kDa

MPAVTYEHIKTCKQSGARLGIVHTPHGSFETPMFMPVGTKATVKTMSPEELRQIEAKIILGNTYHLWLQPGNDIIKHAGGLHKFMNWDGPILTDSGGFQVFSLSNLRKITEEGVEFRHHTNGSKLFLSPEKSMQIQNDLGSDIMMAFDECPPMPAEYDYVKKSIERTTRWAKRCLDAHQRPEDQALFGIIQGGEYEDLREQSAKDLVELDFPGYAIGGLSVGEPKPVMYKMVEHTEQFMPKDKPRYLMGVGSPDALIECSIRGMDMFDCVLPTRIARNGTCMTSQGRLVIKNAKFADDLRPLDENCDCYTCQNYSRAYIRHLIKAEETFGIRLTTIHNLHFLLKLMEDIRQAIREDRLLDFKEEFFEQYGLNVENPKNF

tgt

Queuine tRNA-ribosyltransferase

379 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.31 kDa

MPAVTYEHIKTCKQSGARLGIVHTPHGSFETPMFMPVGTKATVKTMSPEELRQIEAKIILGNTYHLWLQPGNDIIKHAGGLHKFMNWDGPILTDSGGFQVFSLSNLRKITEEGVEFRHHTNGSKLFLSPEKSMQIQNDLGSDIMMAFDECPPMPAEYDYVKKSIERTTRWAKRCLDAHQRPEDQALFGIIQGGEYEDLREQSAKDLVELDFPGYAIGGLSVGEPKPVMYKMVEHTEQFMPKDKPRYLMGVGSPDALIECSIRGMDMFDCVLPTRIARNGTCMTSQGRLVIKNAKFADDLRPLDENCDCYTCQNYSRAYIRHLIKAEETFGIRLTTIHNLHFLLKLMEDIRQAIREDRLLDFKEEFFEQYGLNVENPKNF

tgt

Queuine tRNA-ribosyltransferase

379 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.31 kDa

MPAVTYEHIKTCKQSGARLGIVHTPHGSFETPMFMPVGTKATVKTMSPEELRQIEAKIILGNTYHLWLQPGNDIIKHAGGLHKFMNWDGPILTDSGGFQVFSLSNLRKITEEGVEFRHHTNGSKLFLSPEKSMQIQNDLGSDIMMAFDECPPMPAEYDYVKKSIERTTRWAKRCLDAHQRPEDQALFGIIQGGEYEDLREQSAKDLVELDFPGYAIGGLSVGEPKPVMYKMVEHTEQFMPKDKPRYLMGVGSPDALIECSIRGMDMFDCVLPTRIARNGTCMTSQGRLVIKNAKFADDLRPLDENCDCYTCQNYSRAYIRHLIKAEETFGIRLTTIHNLHFLLKLMEDIRQAIREDRLLDFKEEFFEQYGLNVENPKNF

tgt

Queuine tRNA-ribosyltransferase

379 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.074 kDa

MKEKKEIFTLLHQDAASPARTGVLELPHGKVLTPAFMPVGTAATVKAMTKDDLDEIGFEIILANTYHLFLRPGIEVIKAAGGLHGFSDWKKNFLTDSGGFQVFSLSQLRKITEEGVKFQSHIDGSRQFLSPEIAVELQTGFNSDIQMQLDICSSFGISKTQTLADLKITMNWLDRAFAAWHNTPHEYDGALFPIVQGGFFEDLRLQSLEAILKHEPRGIAIGGLSIGEPKDLYQEYLSFTAKHIPKNKPLYVMGIGTPDYILEAVKNGVDIFDCVLPSRNARNGNLFTHEGAISIKRKEYEFDFNPIDSQCKCKVCRQYTRAYLRHLFRTKEILYSMLATYHNLAFLYSMVQDIREAIQNDSFNDYYKNFLKKYENRLD

tgt

Queuine tRNA-ribosyltransferase

379 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.269 kDa

MKLKFELKKKNGNARRGQLIFERGTVQTPAFMPVGTYGTVKGMTPEEVKETGAQILLGNTFHLWLRPGQEVMKMHGDLHDFMNWQGPILTDSGGFQVFSLGDIRKITEEGVHFRNPVNGDKIFMDAEKSMEIQKDLGSDIVMIFDECTPYPATHDEAKKSMEMSLRWAKRSRDHFDKLENPNNLFGIVQGGVYEDLRDVSVKGLTEIGFDGYAVGGLAVGEPKEDMHRVLEHTCPQLPEDKPRYLMGVGKPEDLVEGVRRGIDMFDCVMPTRNARNGHLFVTGGVIKIRNAAHKTDTTPLDLHCDCYTCKNYSKSYLHHLDRCNEILGARLNTIHNLRYYQRLMESIRKAIDEDRFDQFVAEFYARRNREVPPLQKDKA

tgt

Queuine tRNA-ribosyltransferase

379 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.253 kDa

MKLKFELKKKNGNARRGQLIFERGTVQTPAFMPVGTYGTVKGMTPEEVKETGAQILLGNTFHLWLRPGQEVMKMHGDLHDFMNWQGPILTDSGGFQVFSLGDIRKITEEGVHFRNPVNGDKIFMDAEKSMEIQKDLGSDIVMIFDECTPYPATHDEAKKSMEMSLRWAKRSRDHFDKLENPNNLFGIVQGGVYEDLRDVSVKGLTEIGFDGYAVGGLAVGEPKEDMHRVLEHTCPQLPEDKPRYLMGVGKPEDLVEGVRRGIDMFDCVMPTRNARNGHLFVTGGVIKIRNAAHKTDTTPLDPHCDCYTCKNYSKSYLHHLDRCNEILGARLNTIHNLRYYQRLMESIRKAIDEDRFDQFVAEFYARRNREVPPLQKDKA

tgt

Queuine tRNA-ribosyltransferase

379 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.253 kDa

MKLKFELKKKNGNARRGQLIFERGTVQTPAFMPVGTYGTVKGMTPEEVKETGAQILLGNTFHLWLRPGQEVMKMHGDLHDFMNWQGPILTDSGGFQVFSLGDIRKITEEGVHFRNPVNGDKIFMDAEKSMEIQKDLGSDIVMIFDECTPYPATHDEAKKSMEMSLRWAKRSRDHFDKLENPNNLFGIVQGGVYEDLRDVSVKGLTEIGFDGYAVGGLAVGEPKEDMHRVLEHTCPQLPEDKPRYLMGVGKPEDLVEGVRRGIDMFDCVMPTRNARNGHLFVTGGVIKIRNAAHKTDTTPLDPHCDCYTCKNYSKSYLHHLDRCNEILGARLNTIHNLRYYQRLMESIRKAIDEDRFDQFVAEFYARRNREVPPLQKDKA

tgt

Queuine tRNA-ribosyltransferase

379 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.31 kDa

MPAVTYEHIKTCKQSGARLGIVHTPHGSFETPMFMPVGTKATVKTMSPEELRQIEAKIILGNTYHLWLQPGNDIIKHAGGLHKFMNWDGPILTDSGGFQVFSLSNLRKITEEGVEFRHHTNGSKLFLSPEKSMQIQNDLGSDIMMAFDECPPMPAEYDYVKKSIERTTRWAKRCLDAHQRPEDQALFGIIQGGEYEDLREQSAKDLVELDFPGYAIGGLSVGEPKPVMYKMVEHTEQFMPKDKPRYLMGVGSPDALIECSIRGMDMFDCVLPTRIARNGTCMTSQGRLVIKNAKFADDLRPLDENCDCYTCQNYSRAYIRHLIKAEETFGIRLTTIHNLHFLLKLMEDIRQAIREDRLLDFKEEFFEQYGLNVENPKNF

tgt

Queuine tRNA-ribosyltransferase

379 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.31 kDa

MPAVTYEHIKTCKQSGARLGIVHTPHGSFETPMFMPVGTKATVKTMSPEELRQIEAKIILGNTYHLWLQPGNDIIKHAGGLHKFMNWDGPILTDSGGFQVFSLSNLRKITEEGVEFRHHTNGSKLFLSPEKSMQIQNDLGSDIMMAFDECPPMPAEYDYVKKSIERTTRWAKRCLDAHQRPEDQALFGIIQGGEYEDLREQSAKDLVELDFPGYAIGGLSVGEPKPVMYKMVEHTEQFMPKDKPRYLMGVGSPDALIECSIRGMDMFDCVLPTRIARNGTCMTSQGRLVIKNAKFADDLRPLDENCDCYTCQNYSRAYIRHLIKAEETFGIRLTTIHNLHFLLKLMEDIRQAIREDRLLDFKEEFFEQYGLNVENPKNF

tgt

Queuine tRNA-ribosyltransferase

379 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.31 kDa

MPAVTYEHIKTCKQSGARLGIVHTPHGSFETPMFMPVGTKATVKTMSPEELRQIEAKIILGNTYHLWLQPGNDIIKHAGGLHKFMNWDGPILTDSGGFQVFSLSNLRKITEEGVEFRHHTNGSKLFLSPEKSMQIQNDLGSDIMMAFDECPPMPAEYDYVKKSIERTTRWAKRCLDAHQRPEDQALFGIIQGGEYEDLREQSAKDLVELDFPGYAIGGLSVGEPKPVMYKMVEHTEQFMPKDKPRYLMGVGSPDALIECSIRGMDMFDCVLPTRIARNGTCMTSQGRLVIKNAKFADDLRPLDENCDCYTCQNYSRAYIRHLIKAEETFGIRLTTIHNLHFLLKLMEDIRQAIREDRLLDFKEEFFEQYGLNVENPKNF

tgt

Queuine tRNA-ribosyltransferase

379 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.121 kDa

MPAVTYEHIKTCKQSGARLGIVHTPHGSFETPMFMPVGTKATVKTMSPEELRNIEAKIILGNTYHLWLQPGNDIIKHAGGLHKFMNWDGPILTDSGGFQVFSLSNLRKISEEGVEFRHHTNGSKLFLSPEKSMQIQNDLGSDIMMAFDECPPMPAEYDYVKDSIERTTRWAARCLKAHQRPGDQALFGIIQGGEYKDLREQSAKELVSLDFPGYAIGGLSVGEPKPVMYDMVEHTEQFMPKDKPRYLMGVGSPDALIECSIRGMDMFDCVLPTRIARNGTCMTSNGRLVVKNAKYADDLRPLDEQCDCYTCQHYTRAYIRHLVKAEETFGIRLTTIHNLHFLLKLMEDIRQAIREDRLLDFKDEFFEQYGLNVENPKNF

tgt

Queuine tRNA-ribosyltransferase

379 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.121 kDa

MPAVTYEHIKTCKQSGARLGIVHTPHGSFETPMFMPVGTKATVKTMSPEELRNIEAKIILGNTYHLWLQPGNDIIKHAGGLHKFMNWDGPILTDSGGFQVFSLSNLRKISEEGVEFRHHTNGSKLFLSPEKSMQIQNDLGSDIMMAFDECPPMPAEYDYVKDSIERTTRWAARCLKAHQRPGDQALFGIIQGGEYKDLREQSAKELVSLDFPGYAIGGLSVGEPKPVMYDMVEHTEQFMPKDKPRYLMGVGSPDALIECSIRGMDMFDCVLPTRIARNGTCMTSNGRLVVKNAKYADDLRPLDEQCDCYTCQHYTRAYIRHLVKAEETFGIRLTTIHNLHFLLKLMEDIRQAIREDRLLDFKDEFFEQYGLNVENPKNF

tgt

Queuine tRNA-ribosyltransferase

379 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.31 kDa

MPAVTYEHIKTCKQSGARLGIVHTPHGSFETPMFMPVGTKATVKTMSPEELRQIEAKIILGNTYHLWLQPGNDIIKQVGGLHNFMNWDGPILTDSGGFQVFSLSNLRKITEESVEFRHHTNGLKLFLSPEKSMEIQNDLGSDIMMAFDECPPMPSEYKYVKDSIERTTRWAERCLNAHKRPEDQALFGIIQGGEYKDLREQSAKELVALDFPGYAIGGLSVGEPKPVMYEMVEHTVQYMPDDKPRYLMGVGSPDALIECSIRGMDMFDCVLPTRIARNGTCMTSNGRLVIKNAKYANDFKPLDENCDCYTCKNYSRAYIRHLIKAEETFGIRLTTIHNLHFLLKLMEDIRQAIREDRLLDFKDEFFEQYGLNVENPKNF

tgt

Queuine tRNA-ribosyltransferase

379 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.227 kDa

MTAIRYEFIKTCKQTGARLGRVHTPHGSFDTPTFMPVGTLATVKTMSPEELKAMDSGIILSNTYHLWLRPGHEIIREAGGLHKFMNWDRAILTDSGGFQVFSLSDFRRIEEEGVHFRNHLNGDKLFLSPEKAMEIQNALGSDIMMAFDECPPFPATFEYMKKSVERTSRWAERCLKAHERPQDQGLFGIVQGGEFEELRRQSAKDLVSMDFPGYAVGGLSVGEPKDIMNRVLEFTTPLLPDNKPRYLMGVGSPDSLIDGAIRGIDMFDCVLPTRIARNGTCMTSEGRLVVKNAKFARDFGPLDPNCDCYTCKNYSRAYIRHLMKCDETFGIRLTSYHNLHFLLNLMEQVRQAIREDRLGDFREEFFEQYGFNKPNAKNF

tgt

Queuine tRNA-ribosyltransferase

379 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.227 kDa

MTAIRYEFIKTCKQTGARLGRVHTPHGSFDTPTFMPVGTLATVKTMSPEELKAMDSGIILSNTYHLWLRPGHEIIREAGGLHKFMNWDRAILTDSGGFQVFSLSDFRRIEEEGVHFRNHLNGDKLFLSPEKAMEIQNALGSDIMMAFDECPPFPATFEYMKKSVERTSRWAERCLKAHERPQDQGLFGIVQGGEFEELRRQSAKDLVSMDFPGYAVGGLSVGEPKDIMNRVLEFTTPLLPDNKPRYLMGVGSPDSLIDGAIRGIDMFDCVLPTRIARNGTCMTSEGRLVVKNAKFARDFGPLDPNCDCYTCKNYSRAYIRHLMKCDETFGIRLTSYHNLHFLLNLMEQVRQAIREDRLGDFREEFFEQYGFNKPNAKNF

tgt

Queuine tRNA-ribosyltransferase

379 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.227 kDa

MTAIRYEFIKTCKQTGARLGRVHTPHGSFDTPTFMPVGTLATVKTMSPEELKAMDSGIILSNTYHLWLRPGHEIIREAGGLHKFMNWDRAILTDSGGFQVFSLSDFRRIEEEGVHFRNHLNGDKLFLSPEKAMEIQNALGSDIMMAFDECPPFPATFEYMKKSVERTSRWAERCLKAHERPQDQGLFGIVQGGEFEELRRQSAKDLVSMDFPGYAVGGLSVGEPKDIMNRVLEFTTPLLPDNKPRYLMGVGSPDSLIDGAIRGIDMFDCVLPTRIARNGTCMTSEGRLVVKNAKFARDFGPLDPNCDCYTCKNYSRAYIRHLMKCDETFGIRLTSYHNLHFLLNLMEQVRQAIREDRLGDFREEFFEQYGFNKPNAKNF

tgt

Queuine tRNA-ribosyltransferase

379 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.227 kDa

MTAIRYEFIKTCKQTGARLGRVHTPHGSFDTPTFMPVGTLATVKTMSPEELKAMDSGIILSNTYHLWLRPGHEIIREAGGLHKFMNWDRAILTDSGGFQVFSLSDFRRIEEEGVHFRNHLNGDKLFLSPEKAMEIQNALGSDIMMAFDECPPFPATFEYMKKSVERTSRWAERCLKAHERPQDQGLFGIVQGGEFEELRRQSAKDLVSMDFPGYAVGGLSVGEPKDIMNRVLEFTTPLLPDNKPRYLMGVGSPDSLIDGAIRGIDMFDCVLPTRIARNGTCMTSEGRLVVKNAKFARDFGPLDPNCDCYTCKNYSRAYIRHLMKCDETFGIRLTSYHNLHFLLNLMEQVRQAIREDRLGDFREEFFEQYGFNKPNAKNF

tgt

Queuine tRNA-ribosyltransferase

379 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.227 kDa

MTAIRYEFIKTCKQTGARLGRVHTPHGSFDTPTFMPVGTLATVKTMSPEELKAMDSGIILSNTYHLWLRPGHEIIREAGGLHKFMNWDRAILTDSGGFQVFSLSDFRRIEEEGVHFRNHLNGDKLFLSPEKAMEIQNALGSDIMMAFDECPPFPATFEYMKKSVERTSRWAERCLKAHERPQDQGLFGIVQGGEFEELRRQSAKDLVSMDFPGYAVGGLSVGEPKDIMNRVLEFTTPLLPDNKPRYLMGVGSPDSLIDGAIRGIDMFDCVLPTRIARNGTCMTSEGRLVVKNAKFARDFGPLDPNCDCYTCKNYSRAYIRHLMKCDETFGIRLTSYHNLHFLLNLMEQVRQAIREDRLGDFREEFFEQYGFNKPNAKNF

tgt

Queuine tRNA-ribosyltransferase

379 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.227 kDa

MTAIRYEFIKTCKQTGARLGRVHTPHGSFDTPTFMPVGTLATVKTMSPEELKAMDSGIILSNTYHLWLRPGHEIIREAGGLHKFMNWDRAILTDSGGFQVFSLSDFRRIEEEGVHFRNHLNGDKLFLSPEKAMEIQNALGSDIMMAFDECPPFPATFEYMKKSVERTSRWAERCLKAHERPQDQGLFGIVQGGEFEELRRQSAKDLVSMDFPGYAVGGLSVGEPKDIMNRVLEFTTPLLPDNKPRYLMGVGSPDSLIDGAIRGIDMFDCVLPTRIARNGTCMTSEGRLVVKNAKFARDFGPLDPNCDCYTCKNYSRAYIRHLMKCDETFGIRLTSYHNLHFLLNLMEQVRQAIREDRLGDFREEFFEQYGFNKPNAKNF

tgt

Queuine tRNA-ribosyltransferase

379 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.243 kDa

MTAIRYEFIKTCKQTGARLGRVHTPHGSFDTPTFMPVGTLATVKTMSPEELKAMDSGIILSNTYHLWLRPGHEIIREAGGLHKFMNWDRAILTDSGGFQVFSLSDFRRIEEEGVHFRNHLNGDKLFLSPEKAMEIQNALGSDIMMAFDECPPFPATFEYMKKSVERTSRWAERCLKAHERPQDQGLFGIVQGGEYEELRRQSAKDLVSMDFPGYAVGGLSVGEPKDIMNRVLEFTTPLLPDNKPRYLMGVGSPDSLIDGAIRGIDMFDCVLPTRIARNGTCMTSEGRLVVKNAKFARDFGPLDPNCDCYTCKNYSRAYIRHLMKCDETFGIRLTSYHNLHFLLNLMEQVRQAIREDRLGDFREEFFEQYGFNKPNAKNF

tgt

Queuine tRNA-ribosyltransferase

379 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.227 kDa

MTAIRYEFIKTCKQTGARLGRVHTPHGSFDTPTFMPVGTLATVKTMSPEELKAMDSGIILSNTYHLWLRPGHEIIREAGGLHKFMNWDRAILTDSGGFQVFSLSDFRRIEEEGVHFRNHLNGDKLFLSPEKAMEIQNALGSDIMMAFDECPPFPATFEYMKKSVERTSRWAERCLKAHERPQDQGLFGIVQGGEFEELRRQSAKDLVSMDFPGYAVGGLSVGEPKDIMNRVLEFTTPLLPDNKPRYLMGVGSPDSLIDGAIRGIDMFDCVLPTRIARNGTCMTSEGRLVVKNAKFARDFGPLDPNCDCYTCKNYSRAYIRHLMKCDETFGIRLTSYHNLHFLLNLMEQVRQAIREDRLGDFREEFFEQYGFNKPNAKNF

tgt

Queuine tRNA-ribosyltransferase

379 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.243 kDa

MTAIRYEFIKTCKQTGARLGRVHTPHGSFDTPTFMPVGTLATVKTMSPEELKAMDSGIILSNTYHLWLRPGHEIIREAGGLHKFMNWDRAILTDSGGFQVFSLSDFRRIEEEGVHFRNHLNGDKLFLSPEKAMEIQNALGSDIMMAFDECPPFPATFEYMKKSVERTSRWAERCLKAHERPQDQGLFGIVQGGEYEELRRQSAKDLVSMDFPGYAVGGLSVGEPKDIMNRVLEFTTPLLPDNKPRYLMGVGSPDSLIDGAIRGIDMFDCVLPTRIARNGTCMTSEGRLVVKNAKFARDFGPLDPNCDCYTCKNYSRAYIRHLMKCDETFGIRLTSYHNLHFLLNLMEQVRQAIREDRLGDFREEFFEQYGFNKPNAKNF

tgt

Queuine tRNA-ribosyltransferase

379 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.227 kDa

MTAIRYEFIKTCKQTGARLGRVHTPHGSFDTPTFMPVGTLATVKTMSPEELKAMDSGIILSNTYHLWLRPGHEIIREAGGLHKFMNWDRAILTDSGGFQVFSLSDFRRIEEEGVHFRNHLNGDKLFLSPEKAMEIQNALGSDIMMAFDECPPFPATFEYMKKSVERTSRWAERCLKAHERPQDQGLFGIVQGGEFEELRRQSAKDLVSMDFPGYAVGGLSVGEPKDIMNRVLEFTTPLLPDNKPRYLMGVGSPDSLIDGAIRGIDMFDCVLPTRIARNGTCMTSEGRLVVKNAKFARDFGPLDPNCDCYTCKNYSRAYIRHLMKCDETFGIRLTSYHNLHFLLNLMEQVRQAIREDRLGDFREEFFEQYGFNKPNAKNF

tgt

Queuine tRNA-ribosyltransferase

379 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.266 kDa

MTAIRYEFIKKCKQTGARLGRVHTPHGSFDTPTFMPVGTLATVKTMSPEELKAMDSGIILSNTYHLWLRPGHEIVREAGGLHKFMNWDRAILTDSGGFQVFSLSDFRRIEEEGVYFRNHLNGDKLFLSPEKAMEIQNALGSDIMMAFDECPPFPATFEYMKKSVERTSRWAERCLNAHQRPEDQGLFGIVQGGEFEELRRQSAKDLVSMDFPGYAVGGLSVGEPKDIMNRVLEFTTPLLPENKPRYLMGVGSPDSLIDGAIRGIDMFDCVLPTRIARNGTCMTSQGRLVVKNAKFARDFGPLDPNCDCYTCKNYSRAYIRHLMKCDETFGIRLTSYHNLHFLLNLMEQVRQAIREDRLGDFREEFFEQYGFNKPNAKNF

tgt

Queuine tRNA-ribosyltransferase

379 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.213 kDa

MTAIRYEFIKTCKQTGARLGRVHTPHGSFDTPTFMPVGTLATVKTMSPEELKAMDSGIILSNTYHLWLRPGHEIVREAGGLHKFMNWDRAILTDSGGFQVFSLSDFRRIEEEGVHFRNHLNGDKLFLSPEKAMEIQNALGSDIMMAFDECPPFPATFEYMKKSVERTSRWAERCLKAHERPQDQGLFGIVQGGEFEELRRQSAKDLVSMDFPGYAVGGLSVGEPKDIMNRVLEFTTPLLPDNKPRYLMGVGSPDSLIDGAIRGIDMFDCVLPTRIARNGTCMTSEGRLVVKNAKFARDFGPLDPNCDCYTCKNYSRAYIRHLMKCDETFGIRLTSYHNLHFLLNLMEQVRQAIREDRLGDFREEFFEQYGFNKPNAKNF

tgt

Queuine tRNA-ribosyltransferase

379 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.243 kDa

MTAIRYEFIKTCKQTGARLGRVHTPHGSFDTPTFMPVGTLATVKTMSPEELKAMDSGIILSNTYHLWLRPGHEIIREAGGLHKFMNWDRAILTDSGGFQVFSLSDFRRIEEEGVHFRNHLNGDKLFLSPEKAMEIQNALGSDIMMAFDECPPFPATFEYMKKSVERTSRWAERCLKAHERPQDQGLFGIVQGGEYEELRRQSAKDLVSMDFPGYAVGGLSVGEPKDIMNRVLEFTTPLLPDNKPRYLMGVGSPDSLIDGAIRGIDMFDCVLPTRIARNGTCMTSEGRLVVKNAKFARDFGPLDPNCDCYTCKNYSRAYIRHLMKCDETFGIRLTSYHNLHFLLNLMEQVRQAIREDRLGDFREEFFEQYGFNKPNAKNF

tgt

Queuine tRNA-ribosyltransferase

379 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.227 kDa

MTAIRYEFIKTCKQTGARLGRVHTPHGSFDTPTFMPVGTLATVKTMSPEELKAMDSGIILSNTYHLWLRPGHEIIREAGGLHKFMNWDRAILTDSGGFQVFSLSDFRRIEEEGVHFRNHLNGDKLFLSPEKAMEIQNALGSDIMMAFDECPPFPATFEYMKKSVERTSRWAERCLKAHERPQDQGLFGIVQGGEFEELRRQSAKDLVSMDFPGYAVGGLSVGEPKDIMNRVLEFTTPLLPDNKPRYLMGVGSPDSLIDGAIRGIDMFDCVLPTRIARNGTCMTSEGRLVVKNAKFARDFGPLDPNCDCYTCKNYSRAYIRHLMKCDETFGIRLTSYHNLHFLLNLMEQVRQAIREDRLGDFREEFFEQYGFNKPNAKNF

tgt

Queuine tRNA-ribosyltransferase

379 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

42.846 kDa

MKYELVSTDGRARRGRLIFERGVVETPAFMPVGTYGTVKGMTPEEVAQTGAQILLGNTFHLWLRPGQEIMKLHGDLHDFMQWPGPILTDSGGFQVFSLGAMRKIKEEGVYFRNPINGSPVFLSPEKSMEIQYDLGSDIVMIFDECTPYPADWDYAKRSMEMSLRWAKRSRQRFDELGNQNALFGIIQGSVYEDLRDVSLKGLVEIGFDGYAVGGLAVGEPKEDMHRILEHVCPMIPQDKPRYLMGVGKPEDLVEGVRRGIDMFDCVMPTRNARNGHLFVTGGVVKIRNAQYKEDTTALDPECDCYTCRNYSRAYLHHLDRCNEILGARLNTIHNLRYYQRLMAALRQAIEEGKLERFAADFYGRRGRTVPPLGAADAAS

tgt

Queuine tRNA-ribosyltransferase

379 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

42.951 kDa

MSAIRYELIKTDKQTGARLGKIHTPHGTFDTPMFMPVGTLATVKTMSPEELKAMGAGIILSNTYHLWLRPGEELIREAGGLHKFMNWDQPILTDSGGFQVFSLSKMRDIKEEGVHFRNHLNGDKLFLSPEKAIQIQNALGSDIMMSFDECPPYPASHEYMKKSVERTSRWAERGLKAHERPEDQGLFGIVQGGAYEDLRAQSAKDLVSLDFPGYSIGGLSVGEPKDVMNRVLEHTTPLLPANKPRYLMGVGSPDSLIDGVIRGVDMFDCVLPTRIARNGTCMTSSGRLVIKNAKFTHDFRPIDENCDCYTCKNYSRAYIRHLIRCEETFGIRLTTYHNLHFLLNLMKQVRGAIMEDRLADFREEFFEQYGFNRPDAKNF

tgt

Queuine tRNA-ribosyltransferase

379 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

42.921 kDa

MSAIRYELIKTDKQTGARLGKIHTPHGTFDTPMFMPVGTLATVKTMSPEELKAMGAGIILSNTYHLWLRPGEELIREAGGLHKFMNWDQPILTDSGGFQVFSLSKMRDIKEEGVHFRNHLNGDKLFLSPEKAIQIQNALGSDIMMSFDECPPYPASHEYMKKSVERTSRWAERGLKAHVRPEDQGLFGIVQGGAYEDLRAQSAKDLVSLDFPGYSIGGLSVGEPKDVMNRVLEHTTPLLPANKPRYLMGVGSPDSLIDGVIRGVDMFDCVLPTRIARNGTCMTSSGRLVIKNAKFTHDFRPIDENCDCYTCKNYSRAYIRHLIRCEETFGIRLTTYHNLHFLLNLMKQVRGAIMEDRLADFREEFFEQYGFNRPDAKNF

tgt

Queuine tRNA-ribosyltransferase

379 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

42.923 kDa

MSAIRYELIKTDKQTGARLGKIHTPHGTFDTPMFMPVGTLATVKTMSPEELKAMGAGIILSNTYHLWLRPGEELIREAGGLHKFMNWDQPILTDSGGFQVFSLSKMRDIKEEGVHFRNHLNGDKLFLSPEKAIQIQNALGSDIMMSFDECPPYPASHEYMKKSVERTSRWAERGLQAHARPEDQGLFGIVQGGAYEDLRAQSAKDLVSLDFPGYSIGGLSVGEPKDVMNRVLEHTTPLLPANKPRYLMGVGSPDSLIDGVIRGVDMFDCVLPTRIARNGTCMTSSGRLVIKNAKFTHDFRPIDENCDCYTCKNYSRAYIRHLIRCEETFGIRLTTYHNLHFLLNLMKQVRSAIMEDRLADFREEFFEQYGFNRPDAKNF

tgt

Queuine tRNA-ribosyltransferase

379 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.194 kDa

MNAVTYEHIKTCKQSGARLGIVHTPHGSFETPMFMPVGTQATVKTMSPEELKAMNAKIILSNTYHLWLRPGNDVIREAGGLHKFMNWDGPILTDSGGFQVFSLSDMRKIEEEGVHFRHHLNGSKLFLSPHKAMHIQNDLGSDIMMAFDECPPMPATYEYVKASIERTSRWAERCLEAHQRPEDQALFGIIQGGEYEDLRTQSAKDLVSMDFPGYAIGGLSVGEPKPIMYRMLEHTTPLMPFNKPRYLMGVGSPDALIEGAIRGIDMFDCVLPTRIARNGTCMTSKGRVVVKNAKYERDFTPLDEKCECYTCKNYTKAYLRHLIKADETFGIRLTTIHNLHFLLNLMEQVREAIRNDRLLDFKEEFFEEYGLNVENPKNF

tgt

Queuine tRNA-ribosyltransferase

379 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.36 kDa

MKFKLKTTSGAARRGELTFNRPQGEFSVQTPAFMPVGTYGTVKGMTPEEVRATGAEILLGNTFHLWLRPGQEVMRKHGDLHDFMQWHRPILTDSGGFQVFSLGKLRKITEEGVKFQNPINGERIFLSPEKSMEIQYDLGSDIVMIFDECTPYPATFDYAKKSMEMSLRWAKRSRDRFDELGNKNALFGIVQGGTFEELRKVSAENLINIGFDGYAVGGLAVGEPKEEMHRILEFTTPLLPADKPRYLMGVGKPEDLVEGVRRGIDMFDCVMPTRNARNGHLFVTDGIVKIRNAKYKDDTSPLDPHCDCYTCQHYTKSYLYHLDKCGEILGARLNTIHNLRYYQRLMEQIRTAIEQDRFDDFVQEFYARMDKPVPPLQKA

tgt

Queuine tRNA-ribosyltransferase

379 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.062 kDa

MAAVTYELIKTCKQSGARLGKLHTPHGTIETPIFMPVGTLATVKTMSPEELKQLGAQIILSNTYHLWLRPGHDIVKEAGGLHEFMNWDRPILTDSGGFQVFSLSDLRTIEEEGVHFRNHLSGEKLFLSPEGAMEIQNALGSDIMMAFDECPPYPAERDYMRPSVERTSRWAERCLKAHKRPEDQALFGIIQGGEYEDLRRQSAQDITSLDFPGYAIGGVSVGEPKDVMNRVLEFTTPLLPANKPRYLMGVGSPDSLIDGAIRGIDMFDCVLPTRIARNGTCMTSNGRLVVRNAKYARDFRSLDENCDCHVCQTYTRAYIRHLVKCDETFGFRLTTYHNLYFLLKLMKDVRQAILDDRLLDFREEFFEQYGFNQPNAKNF

tgt

Queuine tRNA-ribosyltransferase

379 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.227 kDa

MTAIRYEFIKTCKQTGARLGRVHTPHGSFDTPTFMPVGTLATVKTMSPEELKAMDSGIILSNTYHLWLRPGHEIIREAGGLHKFMNWDRAILTDSGGFQVFSLSDFRRIEEEGVHFRNHLNGDKLFLSPEKAMEIQNALGSDIMMAFDECPPFPATFEYMKKSVERTSRWAERCLKAHERPQDQGLFGIVQGGEFEELRRQSAKDLVSMDFPGYAVGGLSVGEPKDIMNRVLEFTTPLLPDNKPRYLMGVGSPDSLIDGAIRGIDMFDCVLPTRIARNGTCMTSEGRLVVKNAKFARDFGPLDPNCDCYTCKNYSRAYIRHLMKCDETFGIRLTSYHNLHFLLNLMEQVRQAIREDRLGDFREEFFEQYGFNKPNAKNF

tgt

Queuine tRNA-ribosyltransferase

379 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.214 kDa

MTAIRYEFIKTCKQTGARLGRVHTPHGSFDTPTFMPVGTLATVKTMSPEELKAMDSGIILSNTYHLWLRPGHEIVREAGGLHKFMNWDRAILTDSGGFQVFSLSDFRRIEEEGVHFRNHLNGDKLFLSPEKAMEIQNALGSDIMMAFDECPPFPATFEYMKKSVERTSRWAERCLKAHERPQDQGLFGIVQGGEFEELRRQSAKDLVSMDFPGYAIGGLSVGEPKDIMNRVLEFTTPLLPDDKPRYLMGVGSPDSLIDGAIRGVDMFDCVLPTRIARNGTCMTSEGRLVVKNAKFARDFGPLDPNCDCYTCKNYSRAYIRHLMKCDETFGIRLTSYHNLHFLLNLMEQVRQAIREDRLGDFREEFFEQYGFNKPNAKNF

tgt

Queuine tRNA-ribosyltransferase

379 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

42.981 kDa

MSAIRYELIKTDKQTGARLGKIHTPHGTFDTPMFMPVGTLATVKTMSPEELKAMGAGIILSNTYHLWLRPGEELIREAGGLHKFMNWDQPILTDSGGFQVFSLSKMRDIKEEGVHFRNHLNGDKLFLSPEKAIQIQNALGSDIMMSFDECPPYPASHEYMKKSVERTSRWAERGLKAHERPEDQGLFGIVQGGAYEDLRAQSAKDLVSLDFPGYSIGGLSVGEPKDVMNRVLEHTTPLLPANKPRYLMGVGSPDSLIDGVIRGVDMFDCVLPTRIARNGTCMTSSGRLVIKNAKFTHDFRPIDENCDCYTCKNYSRAYIRHLIRCEETFGIRLTTYHNLHFLLNLMKQVRSAIMEDRLADFREEFFEQYGFNRPDAKNF

tgt

Queuine tRNA-ribosyltransferase

379 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

42.921 kDa

MSAIRYELIKTDKQTGARLGKIHTPHGTFDTPMFMPVGTLATVKTMSPEELKAMGAGIILSNTYHLWLRPGEELIREAGGLHKFMNWDQPILTDSGGFQVFSLSKMRDIKEEGVHFRNHLNGDKLFLSPEKAIQIQNALGSDIMMSFDECPPYPASHEYMKKSVERTSRWAERGLKAHVRPEDQGLFGIVQGGAYEDLRAQSAKDLVSLDFPGYSIGGLSVGEPKDVMNRVLEHTTPLLPANKPRYLMGVGSPDSLIDGVIRGVDMFDCVLPTRIARNGTCMTSSGRLVIKNAKFTHDFRPIDENCDCYTCKNYSRAYIRHLIRCEETFGIRLTTYHNLHFLLNLMKQVRGAIMEDRLADFREEFFEQYGFNRPDAKNF

tgt

Queuine tRNA-ribosyltransferase

379 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

42.921 kDa

MSAIRYELIKTDKQTGARLGKIHTPHGTFDTPMFMPVGTLATVKTMSPEELKAMGAGIILSNTYHLWLRPGEELIREAGGLHKFMNWDQPILTDSGGFQVFSLSKMRDIKEEGVHFRNHLNGDKLFLSPEKAIQIQNALGSDIMMSFDECPPYPASHEYMKKSVERTSRWAERGLKAHVRPEDQGLFGIVQGGAYEDLRAQSAKDLVSLDFPGYSIGGLSVGEPKDVMNRVLEHTTPLLPANKPRYLMGVGSPDSLIDGVIRGVDMFDCVLPTRIARNGTCMTSSGRLVIKNAKFTHDFRPIDENCDCYTCKNYSRAYIRHLIRCEETFGIRLTTYHNLHFLLNLMKQVRGAIMEDRLADFREEFFEQYGFNRPDAKNF

tgt

Queuine tRNA-ribosyltransferase

378 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.1 kDa

MKLKFDLKKKNGNARRGQLTFERGTVQTPAFMPVGTYGTVKGMTPEEVKETGAEILLGNTFHLWLRPGQEVMKMHGDLHDFMNWQGPILTDSGGFQVFSLGDIRKITEEGVHFRNPVNGDKIFMDAEKSMEIQKDLGSDIVMIFDECTPYPATHAEAKKSMEMSLRWAQRSRDHFDKLENPNNLFGIVQGGVYEDLRDVSVKGLTEIGFDGYAVGGLAVGEPKEDMHRVLEHTCPQLPEDKPRYLMGVGKPEDLVEGVRRGIDMFDCVMPTRNARNGHLFVTGGVIKIRNATHKTDTTPLDPHCDCYTCKNYSKSYLHHLDRCNEILGARLNTIHNLRYYQRLMESIRKAIDEDRFEQFVEEFYARRNREVPPLGKQA

tgt

Queuine tRNA-ribosyltransferase

378 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.1 kDa

MKLKFDLKKKNGNARRGQLTFERGTVQTPAFMPVGTYGTVKGMTPEEVKETGAEILLGNTFHLWLRPGQEVMKMHGDLHDFMNWQGPILTDSGGFQVFSLGDIRKITEEGVHFRNPVNGDKIFMDAEKSMEIQKDLGSDIVMIFDECTPYPATHAEAKKSMEMSLRWAQRSRDHFDKLENPNNLFGIVQGGVYEDLRDVSVKGLTEIGFDGYAVGGLAVGEPKEDMHRVLEHTCPQLPEDKPRYLMGVGKPEDLVEGVRRGIDMFDCVMPTRNARNGHLFVTGGVIKIRNATHKTDTTPLDPHCDCYTCKNYSKSYLHHLDRCNEILGARLNTIHNLRYYQRLMESIRKAIDEDRFEQFVEEFYARRNREVPPLGKQA

tgt

Queuine tRNA-ribosyltransferase

378 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.029 kDa

MKYELQKTDGRARRGRLVFERGVVETPAFMPVGTYGTVKGMTPEEVKETGAQILLGNTFHLWLRPGQEIMKLHGDLHDFMQWHGPILTDSGGFQVFSLGAMRKIKEEGVTFQNPINGDKVFLSPEKSMEIQYDLGSDIVMIFDECTPYPADWDYAKRSMEMSLRWAKRSRDRFDELNNKNALFGIIQGGVYEDLRDVSVKGLVDIGFDGYAVGGLAVGEPKEDMHRILEHVCPQIPADKPRYLMGVGKPEDLVEGVRRGIDMFDCVMPTRNARNGHLFVTDGVVKIRNAKHKSDTATLDEHCDCYTCRNYSRAYLHHLDRCNEILGARLNTIHNLRYYQRLMASLRQAIEEGKLESFVEYFYGRIGKPVPPLSPQLTD

tgt

Queuine tRNA-ribosyltransferase

378 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.001 kDa

MKFELKTTDGRARRGQLVFERGTVQTPAFMPVGTYGTVKGMTPEEVRETGAQILLGNTFHLWLRPGQEVMRAHGDLHDFMNWQGPILTDSGGFQVFSLGHIRKITEAGVHFRHPINGEKIFLDPEKSMEIQYDLGSDIVMIFDECTPYPATYEEARKSMEMSLRWGKRSRDKFDALGNKNALFGIIQGSVYEDLRDVSLDGLLEIGFDGYAVGGLAVGEPKEDMHRILEHVCPKIPADKPRYLMGVGKPEDLVEGVRRGIDMFDCVMPTRNARNGHLFTTDGVVKIRNAKYREDTSTLDADCDCYTCKNYTRSYLYHLDKCNEILGARLNTIHNLRYYQRVMQGLRDAIEQGKLDDFVTEFYRRQGKPVPPLAENDVK

tgt

Queuine tRNA-ribosyltransferase

378 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

42.959 kDa

MKFELKTTDGRARRGQLVFERGTVQTPAFMPVGTYGTVKGMTPEEVRETGAEILLGNTFHLWLRPGQEVMRAHGDLHDFMNWQGPILTDSGGFQVFSLGHIRKITEAGVHFRHPINGEKIFLDPEKSMEIQYDLGSDIVMIFDECTPYPATYEEARKSMEMSLRWGKRSRDKFDALGNKNALFGIIQGSVYEELRDVSLNGLLEIGFDGYAVGGLAVGEPKEDMHRILEHVCPKIPADKPRYLMGVGKPEDLVEGVRRGVDMFDCVMPTRNARNGHLFTTDGVVKIRNAKYRSDTSTLDADCDCYTCKNYTRSYLYHLDKCNEILGARLNTIHNLRYYQRVMQGLRDAIEQGKLDDFVTEFYRRQGKPVPPLAENDVK

tgt

Queuine tRNA-ribosyltransferase

378 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

41.054 kDa

MTASFAFTIEHRDGEARAGTFATPHGPVYTPCFMPVGTQATVKTLTPAQLAETGAQMILANTYHLSLQPGADIVAGAGGLHGFMQWPGPILTDSGGFQVFSLSSLRTIDDDGVTFREPKSGALVRFTPEHAVAVQNALGADVIMAFDECPPYPADREQVEGAVERTLRWFERCVEAHRRSDQALFGIVQGGVWPDLRRRCAEGLVAADLPGYAIGGVSVGEPQTLIERVVRVTAPLLPEHKPRYLMGVGTFREMAQAVAVGVDLFDCVMPTRVARHGSALLLGTGGDRRINLKNAQFRRDYEPLDCVCPCYTCRHFSRAYLAHLVRSEEILAMTLLSIHNVATLTRFAALLRCAIATGSFAQEFAHYLQSGPEPVLSN

tgt

Queuine tRNA-ribosyltransferase

378 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.166 kDa

MKLSFDLKKKNGNARRGQLTFERGTVQTPAFMPVGTYGTVKGMTPEEVKGTGAEILLGNTFHLWLRPGQEVMKMHGDLHDFMNWHGPILTDSGGFQVFSLGKMRKITEKGVHFRSPVNGDKIFMDAEKSMEIQKDLGSDIVMIFDECTPYPATHNEAKKSMEMSLRWAQRSRDHFDKLENPNNLFGIVQGGVYEDLRDVSIKGLTEIGFDGYAVGGLAVGEPKEDMHRILEHTCPQLPEDKPRYLMGVGKPEDLVEGVRRGIDMFDCVMPTRNARNGHLFVTGGVIKIRNAKHKTDTTPLDPHCDCYTCQHYSKSYLHHLERCNEILGARLNTIHNLRYYQRLMESIRKAIDEDRFDEFVTEFYERRGREVPPLAKEQ

tgt

Queuine tRNA-ribosyltransferase

378 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

42.993 kDa

MKLKYELKKTNSGARRGQLQFERGTVETPAFMPVGTYGTVKGMTPEEVKDTGAEILLGNTFHLWLRPGQEIMKLHGDLHDFMNWKGPILTDSGGFQVFSLGATRKITEEGVHFRNPVNGDKIFMDAEKSMEIQKDLGSDIVMIFDECTPYPATHKEAKDSMEMSLRWAQRSRDHFDKQENPNSLFGIVQGGVYEDLRDVSVKGLTEIGFDGYAVGGLAVGEPKEDMHRILEHTCPQLPEDKPRYLMGVGKPEDLVEGVRRGIDMFDCVMPTRNARNGHLFVTEGVIKIRNAKHKTDTTPLDSDCDCYTCKNYSKSYLHHLDRCNEILGARLNTIHNLRFYQRVMSDIRQSIDEDRFEEFVAEFYARMGREVPPLGKES

tgt

Queuine tRNA-ribosyltransferase

378 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.654 kDa

MFKFHLITKDGKARRGRIYTPHGVIETPVFMPVGTQGTVKAMLHKLLDEIGTQIILGNTYHLYLRPGTEIIKKAGGLHRFISWNKPILTDSGGYQVFSLAKGKFGNRKAKVKVSDEGVEFQDHLQGDKHFFTPEKVVEIQEIFGSDIMMPLDECVEYPVDKNYAEKALKRTINWLERSIKAKKREDQVLFGIVQGAFWKDLRKKAVEETLKFDEFLFGYSIGGLSVGEPKEIMYGMTEVVCELLPEKKPRYLMGVGKPEDILEAVERGVDMFDCVVPTRNARTGTLYTSQGVVDIRHSKWKEDFSPLDPECDCYTCRNFSKAYLRHLFVAEEISAYVLNTIHNLRFYLKMMEEVRKAIEEKRFKELKEKYLQRVKNKL

tgt

Queuine tRNA-ribosyltransferase

378 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

42.663 kDa

MYKILKTDGRAKRAEFTTVHGTVQTPVFMNVGTVAAIKGAVATTDLQQIGTQIELSNTYHLHVRPGDKIIKQLGGLHKFMNWDKPILTDSGGFQVFSLAGLRKIKEEGVTFQSHIDGHKIFMGPEESMQIQSNLGSTIAMAFDECAPAKADRKYIQNSVDRTYRWLERCKKEMARLNSLPDTVNPDQMLFGIDQGGVFNDIRIDHAKRISELDLDGYAVGGLAVGETHEEMYDVLDNVVPYLPQDKPTYLMGVGTPANILESVDRGIDFFDCVYPSRNGRHGHVYTKFGKINLFNAKYETDTAPIEEGCGCPCCQNYSRAYVRHLLKAKEMLGMRLCVLHNLYYYNHLMTDIRAAIEEGRYAGFKEEALYQMKTYDKQ

tgt

Queuine tRNA-ribosyltransferase

378 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

42.585 kDa

MKFEVIQKSGGSRARLGRLLTPHGVVETPCFMPVGTSATVKAIFPKDLEEEGIKLILANAYHLLFRPGISVIKEFGGLHQFMGWNGAILTDSGGFQVFSLSPFCKIFPEGVRFKSPVDGSFLMLTPESAIHAQMELGSDIVMSLDHCPPWPSKEKDLLEATRRTIQWAKRGKETWMQQQEKLFSKPSASYSLFGIIQGGTDERLRLYCSEELMKIGFDGYAIGGLSVGEPHEESLAVVKTVSSFLDEKAPKYVMGMGQPWQIVQMVDLGIDLFDCVLPTRLARHGSAYVEEGIIHIKNARFRKDGSPLDSRCSCYACRKFSRGYIHHLLKSKEILGIMLLSMHNLLFYNRLMKEIRSFLAHGQWVDFLARWKDKKVTK

tgt

Queuine tRNA-ribosyltransferase

378 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.264 kDa

MEFRIDSIDGNARACTIKTEHSEIKTPIFMPVGTAAAVKSLDAIDMMEILDAPIILGNTYHLYLRPGDEIISKLGGLHGFSGYKRSFLTDSGGFQAFSLGDNVKFTDEGIWFKSHIDGSKHFFSPEKVIDIEYNLNSDIMMVLDDLIALPNTKERIKKSIERTTEWAYRSLVHHVNRGKKNNLFAIIQGGTDFEFRRISAESLVSLEYKGYTFDGFAIGGLSVGEENQLMYDTIEATTPYMPKDKPRYLMGVGTPEDIIEAVERGVDMFDCVMPTRNARNGYLFTTFGTLRIKNAKYKLDESPIDPKCNCYTCRNFSRAYLNHLFKAKELTYFRLASIHNLHYYLNFVKEIREAILEGRFKEYKKEFYSLRAMNSLEI

tgt

Queuine tRNA-ribosyltransferase

378 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

41.701 kDa

MFEFVCQQECAHTQARAGLFHTPHGTVATPRFMPVGTLANVKTLTPEHLKAAGAQMILANTYHLHLQPGEDIVAAAGGLHCFMGWSGPILTDSGGFQVFSLSEMRQISDQGVVFRSPHDGQIIELSPEGAIAIQEALGADVIMAFDECPPYPASREAVIQATQRTLQWLERCIVAKQRSDQALFAIVQGGVYADLRRECAEAMVPYDLPGYAIGGVSVGEPNRIMHEIVAVTAPLLPVHKPRYLMGVGTHLEMLRAIAAGVDLFDCVIPTRLARHGCAIVQGQRWNLKNARFRRDYEPLDPTCPCYTCRTFSRAYLSHLVRAKELLAYTLLSIHNVTELIRFTQAARQAILEERFAAFAAEWEQRLVVDAEEPDAALL

tgt

Queuine tRNA-ribosyltransferase

378 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.608 kDa

MVFRVLQTDGDARVGKLTCHHGIIETPAFIPVGTYGVVKSVTSQEVAESGAQIILSNTFHLWLRPGLEIIKIHQNLHKFMNWMGPIITDSGGFQVFSLNKLRKITESGVYFKDPVNGSTIFLTPEKSMDIQYHLGSDIVLVFDECVSYPSTWEYIKNSVEISLNWAERSRLHFDKLHNSNMLFAIIQGGMYEELRNRSAQELINIKFDGYAIGGLSVGETPQERFRIVSYVCKIIPFDKPRYLMGVGKPQDLIEAVCLGVDMFDCVIPTRNARNGYLFTNNGVVRIRNAKYESDLDPIEEDCDCYTCQRYYSRSYLHYLDRCNESLGIRLNTIHNLRYYQRLMEEIRQSIRMKKLRKFVEAFNYKFNSVSTNNYLSNI

tgt

Queuine tRNA-ribosyltransferase

378 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

42.718 kDa

MYKLICKDGNAKRGEFTTVHGKIQTPVFMNVGTAAAIKGAVSTMDLQEIGTQVELSNTYHLHVRPGDEVVKKLGGLHKFMVWDKPILTDSGGFQVFSLAGLRKIKEEGVYFNSHIDGKKIFMGPEESMRIQSNLASTIAMAFDECPPHPATREYMEDSVARTTRWLLRCKNEMNRLNTLEDTINKHQMLFGINQGGTYTDIRVEHAKRISELDLDGYALGGLAVGESHSEMYRIIEETVPYLPEAKPTYLMGVGTPANILEAVERGVDFFDCVYPARNGRHGHAYTNHGKMNLLNAKYELDDRPIEEGCGCPVCKNYSRGYIRHLLKAKEMLGLRFLVTHNLYFYNKMMEEIREAIENQNFASYKKKKLEGFAAEQGN

tgt

Queuine tRNA-ribosyltransferase

377 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

42.638 kDa

MNFTLHVTDGRARAATLELAHGSIPTPIFMPVGTQASVKALDHTDLLEHIDAPIILGNTYHLYLRPGDENIAKLGGLHGFTKFPRNFLTDSGGFQAFSLNTNTKHSEEGIIFKSHIDGSKHLFTPEKVLEIEYNLNSDIMMVLDDLVGLPAPRERIKESIERTTRWAERSLLFHQAQKEQGKALTNHLFAIVQGGTDVEFREISSKALVGLGEFDGFAIGGLAVGEPNEEMYATLEYTTPWLPKHKPRYLMGVGTPEDIIEAIDRGVDMFDCVMPTRNARNGTLFTHFGKLSIKSPRYKLDENPIDSECDCYTCKHHSRAYLNHLYRSGEFSYFRLASIHNLRYYLNLVRGAREAILSRTWAEYRRQFYAKRGADEA

tgt

Queuine tRNA-ribosyltransferase

377 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

41.373 kDa

MSRLQFQLQATDGAARRGQLSFPCGTVQTPTFMPVGTYGAVKGVLPGQLCDLGAEIILGNTFHLFLRPGLEVIADHGGLHGFMRWNGPILTDSGGFQVFSLAHRRKISEQGVTFAAPTDGAQVFLGPEESMKIQKVLNSDVVMIFDECTPYPATEDVARDSMELSLRWAQRSRDAHDALDNDAALFGIIQGGVHPDLRGRSLDGLQAIGFDGYGIGGLAVGESESERNVILEYLHPRLPTDRPRYLMGVGRPEDLVESVARGVDMFDCVMPTRHARNGQYFTGFGTVKIRNACYARDVDPIEQGCGCPACVGGYTRAYLRHLDRCNEMLASMLGSLHNLWYYETLMANMRAAITAGTFFAFRRSFYLARGLDPPPLP

tgt

Queuine tRNA-ribosyltransferase

377 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

41.373 kDa

MSRLQFQLQATDGAARRGQLSFPCGTVQTPTFMPVGTYGAVKGVLPGQLCDLGAEIILGNTFHLFLRPGLEVIADHGGLHGFMRWNGPILTDSGGFQVFSLAHRRKISEQGVTFAAPTDGAQVFLGPEESMKIQKVLNSDVVMIFDECTPYPATEDVARDSMELSLRWAQRSRDAHDALDNDAALFGIIQGGVHPDLRGRSLDGLQAIGFDGYGIGGLAVGESESERNVILEYLHPRLPTDRPRYLMGVGRPEDLVESVARGVDMFDCVMPTRHARNGQYFTGFGTVKIRNACYARDVDPIEQGCGCPACVGGYTRAYLRHLDRCNEMLASMLGSLHNLWYYETLMANMRAAITAGTFFAFRRSFYLARGLDPPPLP

tgt

Queuine tRNA-ribosyltransferase

377 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

42.912 kDa

MKFEKLGQSGRARRGRLTLEHGVVETPVFMPVGTYGTVKGMLPRDIEDIQAQIILGNTFHLYLRPGLEVIKQHGGLHDFIKWNKPILTDSGGFQVFSLGAMRKIKEEGVTFRSPIDGSKVFLSPEISMEIQHVLNSDIVMIFDECTPYPATHEEAQKSLQLSLRWAKRCKAHHHDELKNKNALFGIIQGGMYEDLRDESLNGLLEIGFDGYAIGGLSVGEPKEEMIKVLDYLPNKMPHDKPRYLMGVGKPEDIVEAVRRGVDMFDCVMPTRNARNGHYFVTDGLVRIRNSKYRHDQGPLDPHCDCYTCKNFTRAYLFHLEKCGEMLASMLGTIHNLRYYQRLTEGMRDALDNGTFDEFVQDFYARRGLEVPPCPVDE

tgt

Queuine tRNA-ribosyltransferase

377 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

42.942 kDa

MKFEKLGQSGRARRGRLTLEHGVVETPVFMPVGTYGTVKGMLPRDIEDIQAQIILGNTFHLYLRPGLEVIKQHGGLHDFIKWNKPILTDSGGFQVFSLGAMRKIKEEGVTFRSPIDGSKVFLSPEISMEIQHVLNSDIVMIFDECTPYPATHEEAQKSLQLSLRWAKRCKTHHHDELKNKNALFGIIQGGMYEDLRDESLNGLLEIGFDGYAIGGLSVGEPKEEMIKVLDYLPNKMPHDKPRYLMGVGKPEDIVEAVRRGVDMFDCVMPTRNARNGHYFVTDGLVRIRNSKYRHDQGPLDPHCDCYTCKNFTRAYLFHLEKCGEMLASMLGTIHNLRYYQRLTEGMRDALDNGTFDEFVQDFYARRGLEVPPCPVDE

tgt

Queuine tRNA-ribosyltransferase

377 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

42.94 kDa

MKFEKLGQSGRARRGRLTLEHGVVETPIFMPVGTYGTVKGMLPRDIEDIQAQIILGNTFHLYLRPGLEVIKQHGGLHDFIKWNKPILTDSGGFQVFSLGAMRKIKEEGVTFRSPIDGSKVFLSPEISMEIQHVLNSDIVMIFDECTPYPATHEEAQKSLQLSLRWAKRCKAHHHDELKNKNALFGIIQGGMYEDLRDESLNGLLEIGFDGYAIGGLSVGEPKEEMIKVLDYLPNKMPHDKPRYLMGVGKPEDIVEAVRRGVDMFDCVMPTRNARNGHYFVTDGLVRIRNSKYRHDQGPLDPHCDCYTCKNFTRAYLFHLEKCGEMLASMLGTIHNLRYYQRLTEGMRDALDKGTFDEFVQDFYARRGLEVPPCPVDE

tgt

Queuine tRNA-ribosyltransferase

377 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

42.912 kDa

MKFEKLGQSGRARRGRLTLEHGVVETPVFMPVGTYGTVKGMLPRDIEDIQAQIILGNTFHLYLRPGLEVIKQHGGLHDFIKWNKPILTDSGGFQVFSLGAMRKIKEEGVTFRSPIDGSKVFLSPEISMEIQHVLNSDIVMIFDECTPYPATHEEAQKSLQLSLRWAKRCKAHHHDELKNKNALFGIIQGGMYEDLRDESLNGLLEIGFDGYAIGGLSVGEPKEEMIKVLDYLPNKMPHDKPRYLMGVGKPEDIVEAVRRGVDMFDCVMPTRNARNGHYFVTDGLVRIRNSKYRHDQGPLDPHCDCYTCKNFTRAYLFHLEKCGEMLASMLGTIHNLRYYQRLTEGMRDALDNGTFDEFVQDFYARRGLEVPPCPVDE

tgt

Queuine tRNA-ribosyltransferase

377 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

42.912 kDa

MKFEKLGQSGRARRGRLTLEHGVVETPVFMPVGTYGTVKGMLPRDIEDIQAQIILGNTFHLYLRPGLEVIKQHGGLHDFIKWNKPILTDSGGFQVFSLGAMRKIKEEGVTFRSPIDGSKVFLSPEISMEIQHVLNSDIVMIFDECTPYPATHEEAQKSLQLSLRWAKRCKAHHHDELKNKNALFGIIQGGMYEDLRDESLNGLLEIGFDGYAIGGLSVGEPKEEMIKVLDYLPNKMPHDKPRYLMGVGKPEDIVEAVRRGVDMFDCVMPTRNARNGHYFVTDGLVRIRNSKYRHDQGPLDPHCDCYTCKNFTRAYLFHLEKCGEMLASMLGTIHNLRYYQRLTEGMRDALDNGTFDEFVQDFYARRGLEVPPCPVDE

tgt

Queuine tRNA-ribosyltransferase

377 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

41.075 kDa

MLMSLTLSLQAEDGRARAATLHTAHGDVPTPTFMPVGTAATVKAMMMDSVRATGAGIVLGNTYHLMLRPGADRVAALGGLHRFMDWPGPILTDSGGFQVMSLSSLRKLDKDGVTFQSHIDGSRHRLTPESSIGIQHKLDATITMAFDECTKFPATHEEAASSMELSMRWAARCRDAFVPRDGYGLFGIVQGSVYNDLRTQSVTALGDDFHGYAVGGLAVGEGQEAMFATLDHTLPLLPRGKPRYLMGVGTPDDILGAVMRGVDMFDCVMPTRAGRTARAYTSQGVMNMRNARYADDGRPIDPACDCPACTRHSRAYLHHLFRAGEMLGPMLLTWHNLNYYQSLMRGLRSAIMEGRLEQHAVTLRAAWAAGDREKQDG

tgt

Queuine tRNA-ribosyltransferase

377 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.027 kDa

MKLKFDLKKKNGNARRGQLTFERGTVQTPAFMPVGTYGTVKGMTPEEVKGTGAEILLGNTFHLWLRPGQEVMKMHGDLHDFMNWHGPILTDSGGFQVFSLGKMRTITEKGVHFRNPVNGDKIFMDAEKSMEIQKDLGSDIVMIFDECTPYPATHNEAKKSMEMSLRWAQRSRDHFDKLENPNNLFGIVQGGVYEDLRDVSVKGLTEIGFDGYAVGGLAVGEPKEDMHRILEHTCPQLPEDKPRYLMGVGKPEDLVEGVRRGIDMFDCVMPTRNARNGHLFVTGGVIKIRNAKHKTDTTPLDPHCDCYTCQNYSKSYLHHLERCNEILGARLNTIHNLRYYQRLMESIRKAIDEDRFDEFVQEFYARRDREVPPLSKA

tgt

Queuine tRNA-ribosyltransferase

377 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

42.704 kDa

MKFELDTTQGRARRGRLIFDRGTVETPAFMPVGTYGTVKGMTPEEVRATGADILLGNTFHLWLRPGEEIMRKHGDLHDFMNWQRPILTDSGGFQVFSLGDIRKITEEGVHFRSPINGEKIFLDPEKSMQIQDSLGSDVVMIFDECTPYPATEDEARKSMQMSLRWAQRSRDEFDRLENPNALFGIIQGGVYEDLRDESLTGLVNIGFDGYAIGGLAVGEPKPDMHRILEHVCPQIPADKPRYLMGVGKPEDLVEGVRRGVDMFDCVMPTRNARNGHLFTSEGVIKIRNARHRDDTAPLDEKCDCYTCKNYSRAYLYHLDRCNEILGARLNTIHNLRYYQMLMEGLRGAIETGTLDAFVSDFYTGLGREVPEVPELVD

tgt

Queuine tRNA-ribosyltransferase

377 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

42.869 kDa

MKFELDTTQGRARRGRLIFERGTVETPAFMPVGTYGTVKGMTPEEVRATGADILLGNTFHLWLRPGEEIMRKHGDLHDFMNWQRPILTDSGGFQVFSLGDIRKITEEGVHFRSPINGEKIFLDPEKSMQIQDSLGSDVVMIFDECTPYPATEDEARKSMQMSLRWAQRSRDEFDRLENPNSLFGIIQGGVYEDLRDESLNGLVDIGFDGYAVGGLAVGEPKEDMHRILEHVCPKIPADKPRYLMGVGKPEDLVEGVRRGVDMFDCVMPTRNARNGHLFTSEGVIKIRNARHRDDTSPLDDKCDCYTCKNYSRAYLYHLDRCNEILGARLNTIHNLRYYQRLMEGLRGAIETGTLDAFVTEFYTSQGREVPEVPELTD

tgt

Queuine tRNA-ribosyltransferase

377 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

42.913 kDa

MKFELDTTQGRARRGRLIFERGTVETPAFMPVGTYGTVKGMTPEEVRETGADILLGNTFHLWLRPGEEIMRKHGDLHDFMNWQRPILTDSGGFQVFSLGDIRKITEEGVHFRSPINGEKIFLDPEKSMQIQDSLGSDVVMIFDECTPYPATEDEARKSMQMSLRWAQRSRDEFDRLENPNSLFGIIQGGVYEDLRDESLNGLVDIGFDGYAVGGLAVGEPKEDMHRILEHVCPKIPADKPRYLMGVGKPEDLVEGVRRGVDMFDCVMPTRNARNGHLFTSEGVIKIRNARHRDDTSPLDDKCDCYTCKNYSRAYLYHLDRCNEILGARLNTIHNLRYYQRLMEGLRGAIETGTLDAFVTEFYTSQGREVPEVPELSD

tgt

Queuine tRNA-ribosyltransferase

377 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

42.904 kDa

MKFELDTTQGRARRGRLVFERGTVETPAFMPVGTYGTVKGMTPEEVRETGADILLGNTFHLWLRPGEEIMRKHGDLHDFMNWQRPILTDSGGFQVFSLGDIRKITEEGVHFRSPINGEKIFLDPEKSMQIQDSLGSDVVMIFDECTPYPATEDEARKSMQMSLRWAQRSRDEFDRLENPNSLFGIIQGGVYEGLRDESLKGLVDIGFDGYAVGGLAVGEPKEDMHRILEHTCPQIPADKPRYLMGVGKPEDLVEGVRRGVDMFDCVMPTRNARNGHLFTSEGVVKIRNARHRDDTSTLDDKCDCYTCKNYSRAYLYHLDRCNEILGARLNTIHNLRYYQRLMEGLRGAIETGTLDDFVTEFYTSQGREVPEVPELTD

tgt

Queuine tRNA-ribosyltransferase

377 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

42.827 kDa

MKFELDTTQGRARRGRLVFERGTVETPAFMPVGTYGTVKGMTPEEVRATGADILLGNTFHLWLRPGEEIMRKHGDLHDFMNWQRPILTDSGGFQVFSLGDIRKITEEGVHFRSPINGEKIFLDPEKSMQIQNSLGSDVVMIFDECTPYPATEDEARKSMQMSLRWAQRSRDEFDKLENPNSLFGIIQGGVYEDLRDESLKGLVDIGFDGYAVGGLAVGEPKADMHRILEHTCPQIPTDKPRYLMGVGKPEDLVEGVRRGVDMFDCVMPTRNARNGHLFTTEGVIKIRNARHRDDTSPLDDKCDCYTCKNYSRAYLYHLDRCNEILGARLNTIHNLRYYQKLMEGLRGAIETGTLDAFVEEFYTSQGREVPEVPELTD

tgt

Queuine tRNA-ribosyltransferase

377 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

41.733 kDa

MATIGEFTLHATDGKARTGVLQTAHGPVRTPIFMPVGTVGSVKGVAPDDLDAIGAEIILGNTYHLYLRPGDELVARRGGLHEFNAWRKPILTDSGGFQVFSLSGLRRISEEGVEFRSHLDGSKHLFTPEKVVSIQRNLNSDIMMVLDECVPYGADKDYTARSLKMTTRWAQRCRDAYPAGSGGNLMFGITQGGFFKDLREESIGELTRIDFDGFALGGLSVGESKTEMMDILYHTAPMLPAHKPRYLMGVGTPLDIINGINAGIDMFDCVLPTRNARNGTLYTSAGKINIKRREFAEDDGPLDPNCSCYTCRTFSRAYLRHLFHAQEILSYRLNSIHNLTYFLDLVRGAREAIAQGTFAEYKSRYDAIYPQEAALCP

tgt

Queuine tRNA-ribosyltransferase

377 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

42.912 kDa

MKFEKLGQSGRARRGRLTLEHGVVETPVFMPVGTYGTVKGMLPRDIEDIQAQIILGNTFHLYLRPGLEVIKQHGGLHDFIKWNKPILTDSGGFQVFSLGAMRKIKEEGVTFRSPIDGSKVFLSPEISMEIQHVLNSDIVMIFDECTPYPATHEEAQKSLQLSLRWAKRCKAHHHDELKNKNALFGIIQGGMYEDLRDESLNGLLEIGFDGYAIGGLSVGEPKEEMIKVLDYLPNKMPHDKPRYLMGVGKPEDIVEAVRRGVDMFDCVMPTRNARNGHYFVTDGLVRIRNSKYRHDQGPLDPHCDCYTCKNFTRAYLFHLEKCGEMLASMLGTIHNLRYYQRLTEGMRDALDNGTFDEFVQDFYARRGLEVPPCPVDE

tgt

Queuine tRNA-ribosyltransferase

377 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

41.452 kDa

MTTENFGFKVLARDGAARQGEISMPRGVVRTPAFMPVGTAGTVKAMYMDQVKELGADIILGNTYHLMLRPGAERVARLGGLHEFGGWKGPILTDSGGFQVMSLAQLRKLNEHGVTFRSHIDGKAYEMTPERSIEIQGLLDSDIQMQLDECVALPSPEKNTERAMELSLRWAERCKVAFGDQPGKAMFGIVQGGDIARLRERSAEALKAMDLKGYSVGGLAVGEPQEVMLDMLEVVCPILPTEKPRYLMGVGTPDDILKSVARGIDMFDCVMPTRAGRHGLAFTRFGKVNLRNARHAEDHRPLDPQSDCPASRDYSRAYLHHLVKSGEALGAMLLTWNNLAYYQYLMKGIRAAIADGNFSDFTAETTEGWARGDMPAL

tgt

Queuine tRNA-ribosyltransferase

377 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

41.466 kDa

MTTENFGFKVLARDGAARQGEISMPRGVVRTPAFMPVGTAGTVKAMYMDQVKELGADIILGNTYHLMLRPGAERVARLGGLHEFGGWKGPILTDSGGFQVMSLAQLRKLNEHGVTFRSHIDGKAYEMTPERSIEIQGLLDSDIQMQLDECVALPSPEKNTERAMELSLRWAERCKVAFGDQPGKAMFGIVQGGDIARLRERSAEALKAMDLKGYSVGGLAVGEPQEVMLDMLEVVCPILPTEKPRYLMGVGTPDDILKSVARGIDMFDCVMPTRAGRHGLAFTRFGKVNLRNARHAEDHRPLDPQSDCPASRDYSRAYLHHLVKSGEALGAMLLTWNNLAYYQYLMKGIRAAIADGKFSDFTAETTEGWARGDMPAL

tgt

Queuine tRNA-ribosyltransferase

376 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

41.945 kDa

MHEKFTFTLKSTSGGARLGEVAMPRGVIRTPAFMPVGTVGTVKAMYLDQVRELGADIILGNTYHLMLRPGPERVARLGGLHELIRWPHPILTDSGGFQVMSLSGLRKLDEKGVTFKSHVDGSLHHMSPERSIEIQGMLDSDIQMQLDECIALPAERKEIERAMEMSLRWAERCRVAFGEQPGKAMFGIVQGGDQPDLRIRSAEGLKELDLKGYAVGGLAVGEPQDVMLGMLDITLPVLPTEKPRYLMGVGTPDDILKSVARGIDMFDCVMPTRSGRHGLAFTRRGRVNIRNARHAEDMRPLDEQSNCPASRDYSRAYLHHLTRSNEALGGMLLSWHNLAYYQELMQGIRTSIEEGRFADFYAETIEMWARGDIDPV

tgt

Queuine tRNA-ribosyltransferase

376 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

42.714 kDa

MYTLLKKTGKVRRGRFETVHGTIETPVFMNVGTLAAIKGAVSSMDLKEINCQVELSNTYHLSLRPGDDVVKKLGGLHKFMNWDRPILTDSGGFQVFSLAEIRKIKEEGVYFNSHIDGRKIFMGPEESMKIQSNLASTIAMAFDECVENPSPREYVERSVERTTRWLVRCKEELDRLNSLPDTINKKQMLFGINQGGVYDDIRIEHAKTIAKMDLDGYAIGGLAVGETHEEMYRIIDAVVPHLPQDKPIYLMGVGTPSNILEAVSRGVDFFDCVLPARNGRHGHVFTKHGKINLRNEKFELDASPIDEGCQCPTCKHYSRAYIRHLFKAKEMLAMRLCVLHNLYFYNTLMEDIRNAIDADCFEEFKNEKLKAWAGKA

tgt

Queuine tRNA-ribosyltransferase

376 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

42.939 kDa

MYKLLKKSGKARRGEFTTPHGVIQTPVFMNVGTLAAIKGAVSSMDLKEIGCQVELSNTYHLHLRPGDEVVKKMGGLHKFMNWDRPILTDSGGFQVFSLSKIRKIQEEGVYFNSHIDGRKIFMGPEESMRIQSNLASTIAMAFDECVENPAPREYVEKSVERTTRWLHRCKDEMNRLNSLPDTINNKQMLFGINQGGTYEDIRIEHAKTIAKMDLDGYAIGGLAVGESHEDMYRIIDAVVPHLPEDKPIYLMGVGIPSNILEAVDRGVDFFDCVLPARNGRHAHVFTKEGKINLLNAKFELDDRPIDEGCQCPACKHYTRSYIRHLFKAKEMLAMRLCVLHNLYFYNNLMEEIRDAIDGNYFKEYKERKLKEWGGRA

tgt

Queuine tRNA-ribosyltransferase

376 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

42.94 kDa

MYKLLKKSGKARRGEFTTPHGVIQTPVFMNVGTLAAIKGAVSSMDLKEIGCQVELSNTYHLHLRPGDEVVKKMGGLHKFMNWDRPILTDSGGFQVFSLSKIRKIQEEGVYFNSHIDGRKIFMGPEESMRIQSNLASTIAMAFDECVENPAPREYVEKSVERTTRWLHRCKDEMNRLNSLPDTINNKQMLFGINQGGTYEDIRIEHAKTIAKMDLDGYAIGGLAVGESHEDMYRIIDAVVPHLPEDKPIYLMGVGIPSNILEAVDRGVDFFDCVLPARNGRHAHVFTKEGKINLLNAKFELDDRPIDEGCQCPACKHYTRSYIRHLFKAKEMLAMRLCVLHNLYFYNNLMEEIRDAIDGDYFKEYKERKLKEWGGRA

tgt

Queuine tRNA-ribosyltransferase

376 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

42.939 kDa

MYKLLKKSGKARRGEFTTPHGVIQTPVFMNVGTLAAIKGAVSSMDLKEIGCQVELSNTYHLHLRPGDEVVKKMGGLHKFMNWDRPILTDSGGFQVFSLSKIRKIQEEGVYFNSHIDGRKIFMGPEESMRIQSNLASTIAMAFDECVENPAPREYVEKSVERTTRWLHRCKDEMNRLNSLPDTINNKQMLFGINQGGTYEDIRIEHAKTIAKMDLDGYAIGGLAVGESHEDMYRIIDAVVPHLPEDKPIYLMGVGIPSNILEAVDRGVDFFDCVLPARNGRHAHVFTKEGKINLLNAKFELDDRPIDEGCQCPACKHYTRSYIRHLFKAKEMLAMRLCVLHNLYFYNNLMEEIRDAIDGNYFKEYKERKLKEWGGRA

tgt

Queuine tRNA-ribosyltransferase

376 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

42.94 kDa

MYKLLKKSGKARRGEFTTPHGVIQTPVFMNVGTLAAIKGAVSSMDLKEIGCQVELSNTYHLHLRPGDEVVKKMGGLHKFMNWDRPILTDSGGFQVFSLSKIRKIQEEGVYFNSHIDGRKIFMGPEESMRIQSNLASTIAMAFDECVENPAPREYVEKSVERTTRWLHRCKDEMNRLNSLPDTINNKQMLFGINQGGTYEDIRIEHAKTIAKMDLDGYAIGGLAVGESHEDMYRIIDAVVPHLPEDKPIYLMGVGIPSNILEAVDRGVDFFDCVLPARNGRHAHVFTKEGKINLLNAKFELDDRPIDEGCQCPACKHYTRSYIRHLFKAKEMLAMRLCVLHNLYFYNNLMEEIRDAIDGDYFKEYKERKLKEWGGRA

tgt

Queuine tRNA-ribosyltransferase

376 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

42.912 kDa

MYKLLKKSGKARRGEFTTPHGVIQTPVFMNVGTLAAIKGAVSSMDLKEIGCQVELSNTYHLHLRPGDEVVKKMGGLHKFMNWDRPILTDSGGFQVFSLSKIRKIQEEGVYFNSHIDGRKIFMGPEESMRIQSNLASTIAMAFDECVENPAPREYVEKSVERTTRWLHRCKDEMNRLNSLPDTINNKQMLFGINQGGTYEDIRIEHAKTIAKMDLDGYAIGGLAVGESHEDMYRIIDAVVPHLPEDKPIYLMGVGIPSNILEAVDRGVDFFDCVLPARNGRHAHVFTKEGKINLLNAKFELDDKPIDEGCQCPACKHYTRSYIRHLFKAKEMLAMRLCVLHNLYFYNNLMEEIRDAIDGDYFKEYKERKLKEWGGRA

tgt

Queuine tRNA-ribosyltransferase

376 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

42.912 kDa

MYKLLKKSGKARRGEFTTPHGVIQTPVFMNVGTLAAIKGAVSSMDLKEIGCQVELSNTYHLHLRPGDEVVKKMGGLHKFMNWDRPILTDSGGFQVFSLSKIRKIQEEGVYFNSHIDGRKIFMGPEESMRIQSNLASTIAMAFDECVENPAPREYVEKSVERTTRWLHRCKDEMNRLNSLPDTINNKQMLFGINQGGTYEDIRIEHAKTIAKMDLDGYAIGGLAVGESHEDMYRIIDAVVPHLPEDKPIYLMGVGIPSNILEAVDRGVDFFDCVLPARNGRHAHVFTKEGKINLLNAKFELDDKPIDEGCQCPACKHYTRSYIRHLFKAKEMLAMRLCVLHNLYFYNNLMEEIRDAIDGDYFKEYKERKLKEWGGRA

tgt

Queuine tRNA-ribosyltransferase

376 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

42.94 kDa

MYKLLKKSGKARRGEFTTPHGVIQTPVFMNVGTLAAIKGAVSSMDLKEIGCQVELSNTYHLHLRPGDEVVKKMGGLHKFMNWDRPILTDSGGFQVFSLSKIRKIQEEGVYFNSHIDGRKIFMGPEESMRIQSNLASTIAMAFDECVENPAPREYVEKSVERTTRWLHRCKDEMNRLNSLPDTINNKQMLFGINQGGTYEDIRIEHAKTIAKMDLDGYAIGGLAVGESHEDMYRIIDAVVPHLPEDKPIYLMGVGIPSNILEAVDRGVDFFDCVLPARNGRHAHVFTKEGKINLLNAKFELDDRPIDEGCQCPACKHYTRSYIRHLFKAKEMLAMRLCVLHNLYFYNNLMEEIRDAIDGDYFKEYKERKLKEWGGRA

tgt

Queuine tRNA-ribosyltransferase

376 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

41.49 kDa

MAKPFSFKVLATDGRARRGIIDMPRGEIRTPAFMPVGTGGTVKTMYMDQVRGVGADIILGNTYHLMLRPGAERVARLGGLHEFARWPHPILTDSGGFQVMSLSKLRKLTEKGVTFRSHIDGAPYEMSPERSIEIQSLLDSDIQMQLDECTALPAELKEIERAMELSLRWAERCKTAFGDQPGKAMFGIVQGGDNAALRVRSAQALSAMGLKGYAVGGLAVGEPQAVMLEMLDITCPELPADKPRYLMGVGTPDDILKSVARGIDMFDCVMPTRAGRHGLAYTRRGKVNLRNARHADDPRPLDEESDCPAARDYSRAYLHHLVRSQEALGAMLLTWNNLSYYQKLMQDIRAAIETQTFEARGAEITEGWARGDIPVL

tgt

Queuine tRNA-ribosyltransferase

376 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

41.797 kDa

MTETFQFKLLAADGNARRGEVVTPRGTIRTPAFMPVGTVGTVKAMYLDQVRDLGADIILGNTYHLMLRPGAERVARLGGLHKFIRWERPILTDSGGFQVMSLSSLRKLNEQGVTFKSHVDGALYHMSPERSIEIQGLLGSDIQMQLDECVALPAEPDEIERAMEMSLRWAERCKVAFGDQPGKAMFGIVQGGDIPRLRERSALALRDLDLKGYAVGGLAVGEPQEVMLGMLDVTCPVLPADKPRYLMGVGTPDDILKSVAHGIDMFDCVMPTRSGRHGLAFTRYGRINLRNARHAEDTRPLDEQSSCPATRDYSRAYLHHLIRSNESLGGMLLSWNNLAYYQELMAGIRKAIEEGRYTDFMAETMEGWQRGDLPPV

tgt

Queuine tRNA-ribosyltransferase

376 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

41.514 kDa

MTQRFSFELTATDGRARTGVISTPRGEIRTPAFMPVGTAGTVKAMLPENVRATGADILLGNTYHLMLRPTAERVARLGGLHRFMNWDRPILTDSGGFQVMSLADLRKLSEEGVTFRSHIDGSKHHLSPERSMEIQRLLGSDIVMAFDECPALPATEEAVAQSMRLSMRWARRSREAFGDRPGHALFGIMQGGVTRDLREESAAALREIGFEGYAIGGLAVGEGQEAMFGVLDYAPGFLPEDRPRYLMGVGKPDDIVGAVERGVDMMDCVLPSRSGRTGQAWTRRGQVNIKNARHMDDPRPLDEACSCPACRSYSRAYLHHVFRAQEIIASMLLTWHNLHYYQELMQGLRTAIAAGRLGEFVAAFHAARAEGDIEPL

tgt

Queuine tRNA-ribosyltransferase

376 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

41.508 kDa

MTQRFSFELTATDGRARTGVISTPRGEIRTPAFMPVGTAGTVKAMLPENVRATGADILLGNTYHLMLRPTAERVVRLGGLHRFMNWDRPILTDSGGFQVMSLADLRKLSEEGVTFRSHIDGSKHHLSPERSMEIQRLLGSDIVMAFDECPALPATEEAVAQSMRLSMRWARRSREAFGDRPGHALFGIMQGGVTRDLREESAAALREIGFEGYAIGGLAVGEGQEAMFGVLDYAPGLLPEDRPRYLMGVGKPDDIVGAVERGVDMMDCVLPSRSGRTGQAWTRRGQVNIKNARHMDDPRPLDEACSCPACRSYSRAYLHHVFRAQEIIASMLLTWHNLHYYQELMQGLRTAIAAGRLGEFVAAFHAARAEGDIEPL

tgt

Queuine tRNA-ribosyltransferase

376 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

43.081 kDa

MKFTLHKTNGMARRGTMTFNRPQGEFTVETPAFMPVGTYGTVKGMTPEEVRVTGAEILLGNTFHLWLRPGQEIMRQHGDLHDFMQWHRPILTDSGGFQVFSLGKLRKITEEGVKFQNPINGERIFLSPEKSMEIQYDLGSDIVMIFDECTPYPATFDYAKKSMEMSLRWAKRSRERFDELGNKNALFGIVQGSTFEDLRKLSIEGLINIGFDGYAVGGLAVGEPKEDMHRILAYVCPQLPADKPRYLMGVGKPEDLVEGVRRGIDMFDCVMPTRNARNGHLFVSNGIVKIRNAKYRNDTTSLDPECDCYTCKHYTKAYLYHLDKCGEILGARLNTIHNLHYYQRLMAQIRQAIEEDRFEDFVVEFYKKIGKSVPTR

tgt

Queuine tRNA-ribosyltransferase

376 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

41.389 kDa

MTRASSFRLDATSGKARTGVIQTPRGDIRTPAFMPVGTAATVKAMMPESVAATGADILLGNTYHLMLRPTAERIANLGGLHSFMNWDKPILTDSGGFQVMSLADLRKLTEEGVTFRSHIDGSKHLLSPERSMEIQKLLGSDIVMCFDECPALPADRKALDDSMRLSMRWAARSKEAFGDRPGYALFGIQQGGLEEDLREESAKALREIGFDGYAVGGLAVGEGQAAMFGCLDFAPDQLPTDKPRYLMGVGKPDDIVGAVKRGIDMMDCVLPSRSGRTGQAWTRRGQVNIKNARHADDPRPLDEDCTCPACRNYSRAYLHHVFRAQEMISGMLLTWHNLHYYQELMQTMRDAIAANDFAGFEARFHADRAEGDIVPL

tgt

Queuine tRNA-ribosyltransferase

376 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

41.607 kDa

MTQRFSFTRLGQDGAARLGRINTPRGEIRTPAFMPVGTAATVKAMRPESVRETGADILLGNTYHLMLRPTAERIARLGGLHRFMNWDRPILTDSGGFQVMSLTGLRKLTEQGVTFKSHIDGSKHMLSPERSMEIQKLLRSDIVMCFDECPALPAPRERITESMELSMRWAARSREAFGDWPGHALFGIQQGGLEEDLRGKSAEALRAIEFDGYAVGGLAVGEGQEAMFGVLDYAPGMLPEDKPRYLMGVGKPGDLVGAVKRGIDMFDCVLPSRSGRTGQVFTRRGVVNIKNARHADDPRPLDEDCTCPACRSYSRAYLHHVFRAGEILSSMLLTWHNLHYYQELMQGMRDAIGAGDFAGFEARFLAQQAEGDIAPV

tgt

Queuine tRNA-ribosyltransferase

376 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

41.51 kDa

MSRLQFQLQTRDGRARRGRLTFPRGTVETPAFMPVGTYGSVKGILPDQVRALGAEIILGNTFHLYLRPGLDIIADHGGLHGFCRWDGPILTDSGGFQVFSLAHRRKITEQGVTFASPTDGARVFLGPEESMKIQKVLDSDVVMIFDECTPYPATEDVARRSMELSLRWAQRSRNAHDELGNDAALFGIVQGGVHTDLRSRSADALQAIGFDGYAIGGLAVGEPEDERNAMLDHLDPELPADRPRYLMGVGRPEDLVEGVARGVDMFDCVMPTRNARNGHYFTSFGTVRIRNSQYARDMDPIEPGCGCVACTGGYTRSYLRHLDRCNEMLAPMLGTLHNLFYYEKLMADIRAAIEAGTFLAFRESFYAARGAVAPPL

tgt

Queuine tRNA-ribosyltransferase

376 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

41.535 kDa

MSRLQFQLQTRDGRARRGRLTFPRGTVETPAFMPVGTYGSVKGILPDDVRALGAEIILGNTFHLYLRPGLDIIADHGGLHGFCRWDGPILTDSGGFQVFSLAHRRKITEQGVTFASPTDGARVFLGPEESMKIQKVLDSDVVMIFDECTPYPATEDVARRSMELSLRWAQRSRNAHDELGNDAALFGIVQGGVHTDLRSRSAEALQAIGFDGYAVGGLAVGEPEHERNAMLDHLDPELPSDRPRYLMGVGRPEDLVEGVARGVDMFDCVMPTRNARNGHYFTSFGTVRIRNSQYARDMDPIEPGCGCVACTGGYTRSYLRHLDRCNEMLAPMLGTLHNLFYYEKLMADIRAAIEAGTFLAFRESFYAARGAVAPPL

tgt

Queuine tRNA-ribosyltransferase

376 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

42.69 kDa

MKFELDTTDGRARRGRLVFERGVVETPAFMPVGTYGTVKGMTPEEVQDTGAQIILGNTFHLWLRPGQEIMKLHGDLHDFMQWKGPILTDSGGFQVFSLGDIRKITEKGVHFRNPINGDAIFLDPEKSMEIQYDLGSDIVMIFDECTPYPADWDYAKRSMEMSLRWAQRSRDRFDSLGNKNALFGIIQGSVYEDLRDVSVKGLVDIGFDGYAVGGLAVGEPKEDMHRILEHVCPQLPQDKPRYLMGVGKPQDLVEGVRRGVDMFDCVMPTRNARNGHLFVSDGVVKIRNAKYKDDISPLDAECDCYTCRNYSRAYLYHLDRCNEILGARLNTIHNLRYYQRLMAGLRQAIEEGKLEHFVSEFYQRTGAAVPPITSDN

tgt

Queuine tRNA-ribosyltransferase

376 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

42.898 kDa

MYKLLKKDGSSRRGEFSTPHGVVQTPVFMNVGTLAAIKGAVSTEDLKEIGCQIELSNTYHLSLRPGDEVIRKLGGLHKFMNWDRPILTDSGGFQVFSLSGMRKIKEEGVYFNSHIDGRKIFMGPEESMRIQSNLASTVAMAFDECVENPAPKEYVEDSVKRTTRWLKRCKIEIDRLNSMPHTINNKQMLFGINQGGVHDDIRMEHAKIISDMDLDGYAIGGLAVGETHEEMYRVLEKVVPNLPENKPIYLMGVGTPANILEAVERGVDFFDCVMPSRNGRHSHVFTSYGVIHLLNAKYELDDNPIDSECSCPTCKNYTRAYIRHLFKAKEMLAMRLCVIHNLYFYNNLMKEIRESIDKGNFLQYKKEKLEKWNETV

tgt

Queuine tRNA-ribosyltransferase

376 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

42.898 kDa

MYKLLKKDGSSRRGEFSTPHGVVQTPVFMNVGTLAAIKGAVSTEDLKEIGCQIELSNTYHLSLRPGDEVIRKLGGLHKFMNWDRPILTDSGGFQVFSLSGMRKIKEEGVYFNSHIDGRKIFMGPEESMRIQSNLASTVAMAFDECVENPAPKEYVEDSVKRTTRWLKRCKIEIDRLNSMPHTINNKQMLFGINQGGVHDDIRMEHAKIISDMDLDGYAIGGLAVGETHEEMYRVLEKVVPNLPENKPIYLMGVGTPANILEAVERGVDFFDCVMPSRNGRHSHVFTSYGVIHLLNAKYELDDNPIDSECSCPTCKNYTRAYIRHLFKAKEMLAMRLCVIHNLYFYNNLMKEIRESIDKGNFLQYKKEKLEKWNETV

tgt

Queuine tRNA-ribosyltransferase

376 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

42.835 kDa

MYTLIKKCGNAKRGRFETPHGTIETPVFMNVGTLGVIKGAVSSMDLKEIGCQVELSNTYHLHLRPGDEVIKKMGGLHKFMNWDRPILTDSGGFQVFSLAKIRKIQEEGVYFNSHIDGRRIFMGPEESMRIQSNIASTIAMAFDECIPNPSTREYVENSVARTTRWLERCKKEMDRLNSLPDTINKKQMLFGINQGGTYEDIRKAHAKTIVDMDLDGYAIGGLAVGETHEEMYRVIDEVAPIFPDNKPLYLMGVGLPSNILEAVDRGVDFFDCVLPARNGRHGHVFTKYGKINLMNAKFELDGNPIDEGCECPACKHYSRAYIRHLFKAKEMLAMRLCVLHNLYFYNKLMEDIRKAIEGDYFKEFKEEKLHNWSGKA

tgt

Queuine tRNA-ribosyltransferase

376 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

42.535 kDa

MLNFELLTTDGNARRGRVTLNHGVVETPIFMPVGTYGSVKAMSPLELNEIGAQIILGNTFHLWLRPGLDVVDTHAGLHKFIGWDKPILTDSGGFQVFSLGELRKITEEGVTFASPVNGDKLFLSPEISMQIQRTLNSDIVMQFDECTPYEIDGRPATHDEAARSMRMSLRWAKRSRDEFDHLANPNALFGIVQGGMFEDLRDESLAGLSELDFHGYAIGGLSVGEPKEDMMRVLEHVGPRLPAHKPHYLMGVGTPEDLVAGVAHGVDMFDCVMPTRNARNGWLFTRFGDVKIRNAAHRNDPRPLDEQCGCYTCRNFSRAYLHHLHRVGEILGARLNTIHNLYYYLELMREMRTAIEEHRFEAFRRQFAENRARGTR

tgt

Queuine tRNA-ribosyltransferase

376 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

42.339 kDa

MLNFELITTDGNARRGRVTLNHGVVETPIFMPVGTYGSVKAMSPLELNEIGAHIILGNTFHLWLRPGLDVVNAHEGLHKFIGWDKPILTDSGGFQVFSLGDLRKITEDGVTFASPVNGDKLFLSPEISMQIQRTLNSDIVMQFDECTPYEIDGRAATHEEAAKSMRMSLRWAKRSRDEFERLANPNALFGIVQGGMYEDLRDESLAGLSELDFHGFAIGGLSVGEPKEDMMRVLEHVAPRLPAHKPHYLMGVGTPEDLVAGVAAGVDMFDCVMPTRNARNGWLFTRFGDVKIKNAAHRNDPRPLDESCACYTCRNFSRAYLHHLHRVGEILGARLNTIHNLHYYLQLMREMREAIEHHRFADFRRQFAADRARGTQ

tgt

Queuine tRNA-ribosyltransferase

376 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

42.47 kDa

MLNFELITTDGNARRGRVTLNHGVVETPIFMPVGTYGSVKAMSPLELNEIGAEIILGNTFHLWLRPGLDVVNTHEGLHRFIGWDKPILTDSGGFQVFSLGDLRKITEDGVTFASPVNGDKLFLSPEISMQIQRTLNSDIVMQFDECTPYEIEGRPATHEEAAKSMRMSLRWAKRSRDEFERLANPNALFGIVQGGMFEDLRDESLAGLSELDFHGFAIGGLSVGEPKEDMMRVLEHVAPRLPADKPHYLMGVGTPEDLVAGVAAGVDMFDCVMPTRNARNGWLFTRYGDVKIRNAAHRNDPRPLDESCACYTCRNFSRAYLHHLHRVGEILGARLNTIHNLHYYLQLMREVRESIEQHRFSDFRRQFASDRARGTR

tgt

Queuine tRNA-ribosyltransferase

376 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

42.364 kDa

MLNFELITTDGNARRGRVTLNHGVVETPIFMPVGTYGSVKAMSPLELNEIGAQIILGNTFHLWLRPGLDVVNAHEGLHRFIGWDKPILTDSGGFQVFSLGDLRKITEDGVTFASPVNGDKLFLSPEISMQIQRTLNSDIVMQFDECTPYEIDGRPATHEEAAKSMRMSLRWARRSRDEFERLANPNALFGIVQGGMYEDLRDESLAGLSELDFHGFAIGGLSVGEPKEDMMRVLEHVAPRLPANKPHYLMGVGTPEDLVAGVAAGVDMFDCVMPTRNARNGWLFTRYGDVKIKNAAHRNDPRPLDESCACYTCRNFSRAYLHHLHRVGEILGARLNTIHNLHYYLQLMREVREAIEQHRFADFRRQFAADRARGTQ

tgt

Queuine tRNA-ribosyltransferase

376 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

41.641 kDa

MSERFSFDLHASDGKARTGVIHTPRGGVRTPAFMPVGTAATVKAMMPESVRATGADILLGNTYHLMLRPTAERIDRLGGLHRFMNWDRPILTDSGGFQVMSLAGLRKLTEKGVTFKSHIDGSKHELTPERSMEIQRLLGSDIVMCFDECPALPADRDRIAESMRLSMRWAERSREAFGDRPGHALFGIMQGGLEQDLREESAQALRSVGFDGYAVGGLAVGEGQAAMFDCLDYAPGFLPEDKPRYLMGVGKPDDIVGAVKRGIDMMDCVLPSRSGRTGQVFTRHGVLNIKNARHMDDPRPLDEACTCPACRNYSRAYLHHVFRSQEIISSMLLTWHNLHYFQEIMQGMREAIAGGTFEAWEAAFHAGRAQGDIEPL

tgt

Queuine tRNA-ribosyltransferase

376 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

41.744 kDa

MAELFNFEMTATDGKARTGVIHTPRGEIRTPAFMPVGTAATVKAMMPESVRATGADILLGNTYHLMLRPTAERIDRLGGLHKFMNWDRPILTDSGGFQVMSLAGLRKLTEKGVTFKSHIDGSRHELTPERSMEIQRLLGSDIVMCFDECPALPADRDRIAESMRLSMRWAERSREAFGDRPGHALFGIQQGGLEQDFREESAEALTKIGFDGYAVGGLAVGEGQEAMFGCLDYAPDMLPVDKPRYLMGVGKPDDIVGAVSRGIDMMDCVLPSRSGRTGQAFTRHGVVNIKNARHQDDPRPLDENCSCPACSNYSRAYLHHVFRSNEMISGMLLTWHNLHYFQDIMAGMRESIAAGTFEAWQKTFHETRAQGDIEPL

tgt

Queuine tRNA-ribosyltransferase

376 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

42.535 kDa

MKFEVIKKDGNARRGILTTAHSVIQTPVFMPVGTVGAVKSLDAFDMSEILDAKIILANTYHMYLRPGSKVVREFGGLHGFSKFDRSFLTDSGGFQAFSLRSNTKNDDGGIKFKSHIDGSTHYFTPRSVLDTQYELGSDIMMILDDLVALPAEPKRIDLSIKRTIKWAKEAIDYHKFMQSKGVGLQQNIFGIVQGGTDYEARKFCAEALNEMPFDGLAIGGLSVGESNEAMYDTVEAVMPFMDELRPRYLMGVGTPEDLVENVERGVDMFDCVMPTRNARNGTLFTSFGKINIKSAKFINDHAPIDPQCQCYTCKRYSRGYLNHLFKARELTFFRLASLHNLHYYLNLMKEMREAIEVGEFAKFKRNFYAKRSTDEL

tgt

Queuine tRNA-ribosyltransferase

375 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

42.741 kDa

MKFELDKTQGRARRGRLQFERGTVETPAFMPVGTYGTVKGMTPEEVKETGAQILLGNTFHLWLRPGQEVMKLHGDLHDFMQWHGPILTDSGGFQVFSLGATRKITEEGVHFRNPVNGDKVFMDAEKSMEIQYDLGSDIVMIFDECTPYPATHDEAKKSMEMSLRWAQRSRNHFDKQENPNALFGIIQGGVYEDLRDVSVDGLTNIGFDGYAVGGLAVGEPKEDMHRILEHTCPQLPEDKPRYLMGVGKPEDLVEGVRRGIDMFDCVMPTRNARNGHLFVTGGVIKIRNAKHKTDTTPLDPHCDCYTCLNYSKAYLYHLDKCNEILGSRLNTIHNLRYYQRLMASIRSAIEEDRFDVFVEEFYARRDREVPPLKNA

tgt

Queuine tRNA-ribosyltransferase

375 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

42.912 kDa

MKYELIKKQGRARRGQLQFDRGTVETPAFMPVGTYGTVKGMTPEEVKGTGAEILLGNTFHLWLRPGQEIMKLHGDLHDFMNWKGPILTDSGGFQVFSLGKTRKITEEGVHFRSPVNGDKIFMDAEKSMQIQYDLGSDVVMIFDECTPYPATHDEARISMERSIRWAERSRNEFDRQENPNALFGIVQGGVYEDLRDVSVEALTKIGFDGYAVGGLAVGEPKEDMHRILEHTCPQLPEDKPRYLMGVGKPEDLVEGVRRGIDMFDCVMPTRNARNGHLFVTGGVIKIRNAKHKTDTTPLDPECDCYTCQNYSKSYLHHLDRCNEILGARLNTIHNLRYYQRIMASIRKALEEDRFEQFVEEFYARRDREVPPLKDL

tgt

Queuine tRNA-ribosyltransferase

375 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

42.912 kDa

MKYELIKKQGRARRGQLQFDRGTVETPAFMPVGTYGTVKGMTPEEVKGTGAEILLGNTFHLWLRPGQEIMKLHGDLHDFMNWKGPILTDSGGFQVFSLGKTRKITEEGVHFRSPVNGDKIFMDAEKSMQIQYDLGSDVVMIFDECTPYPATHDEARISMERSIRWAERSRNEFDRQENPNALFGIVQGGVYEDLRDVSVEALTKIGFDGYAVGGLAVGEPKEDMHRILEHTCPQLPEDKPRYLMGVGKPEDLVEGVRRGIDMFDCVMPTRNARNGHLFVTGGVIKIRNAKHKTDTTPLDPECDCYTCQNYSKSYLHHLDRCNEILGARLNTIHNLRYYQRIMASIRKALEEDRFEQFVEEFYARRDREVPPLKDL

tgt

Queuine tRNA-ribosyltransferase

375 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

42.939 kDa

MKYELIKKQGRARRGQLQFDRGTVETPAFMPVGTYGTVKGMTPEEVKDTGAEILLGNTFHLWLRPGQEIMKLHGDLHDFMNWKGPILTDSGGFQVFSLGKTRKITEEGVHFRSPVNGDKIFMDAEKSMQIQYDLGSDVVMIFDECTPYPATHDEARISMERSIRWADRSRNEFDRQENPNALFGIVQGGVYEDLRDVSVEALTKIGFDGYAVGGLAVGEPKEDMHRILEHTCPLLPEDKPRYLMGVGKPEDLVEGVRRGIDMFDCVMPTRNARNGHLFVTGGIVKIRNAKHKVDTTPLDPECDCYTCQNYSKSYLHHLDRCNEILGARLNTIHNLRYYQRIMASIRKALEEDRFEQFVEEFYARRDREVPPLKDL

tgt

Queuine tRNA-ribosyltransferase

375 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

42.536 kDa

MKFELDTTDGRARRGRLVFDRGVVETPAFMPVGTYGTVKGMTPEEVEATGAQIILGNTFHLWLRPGQEIMKLHGDLHDFMQWKGPILTDSGGFQVFSLGDIRKITEQGVHFRNPINGDPIFLDPEKSMEIQYDLGSDIVMIFDECTPYPADWDYAKRSMEMSLRWAKRSRDRFDGLGNKNALFGIIQGSVYEDLRDISVKGLVEIGFDGYAVGGLAVGEPKEDMHRILEHVCPQIPADKPRYLMGVGKPEDLVEGVRRGIDMFDCVMPTRNARNGHLFVTDGVVKIRNAKHKSDTSPLDAECDCYTCRNYSRAYLHHLDRCNEILGARLNTIHNLRYYQRLMAGLRKAIEEGKLESFVTDFYQRQGRPVPPLNVD

tgt

Queuine tRNA-ribosyltransferase

375 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

42.594 kDa

MKFELDTTDGRARRGRLVFDRGVVETPCFMPVGTYGTVKGMTPEEVEATGAQIILGNTFHLWLRPGQEIMKLHGDLHDFMQWKGPILTDSGGFQVFSLGDIRKITEQGVHFRNPINGDPIFLDPEKSMEIQYDLGSDIVMIFDECTPYPADWDYAKRSMEMSLRWAKRSRERFDSLGNKNALFGIIQGSVYEDLRDISVKGLVDIGFDGYAVGGLAVGEPKADMHRILEHVCPQIPADKPRYLMGVGKPEDLVEGVRRGIDMFDCVMPTRNARNGHLFVTDGVVKIRNAKYKSDTGPLDPECDCYTCRNYSRAYLHHLDRCNEILGARLNTIHNLRYYQRLMAGLRKAIEEGKLESFVTDFYQRQGREVPPLNVD

tgt

Queuine tRNA-ribosyltransferase

375 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

42.594 kDa

MKFELDTTDGRARRGRLVFDRGVVETPCFMPVGTYGTVKGMTPEEVEATGAQIILGNTFHLWLRPGQEIMKLHGDLHDFMQWKGPILTDSGGFQVFSLGDIRKITEQGVHFRNPINGDPIFLDPEKSMEIQYDLGSDIVMIFDECTPYPADWDYAKRSMEMSLRWAKRSRERFDSLGNKNALFGIIQGSVYEDLRDISVKGLVDIGFDGYAVGGLAVGEPKADMHRILEHVCPQIPADKPRYLMGVGKPEDLVEGVRRGIDMFDCVMPTRNARNGHLFVTDGVVKIRNAKYKSDTGPLDPECDCYTCRNYSRAYLHHLDRCNEILGARLNTIHNLRYYQRLMAGLRKAIEEGKLESFVTDFYQRQGREVPPLNVD

tgt

Queuine tRNA-ribosyltransferase

375 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

42.608 kDa

MKFELDTTDGRARRGRLVFDRGVVETPCFMPVGTYGTVKGMTPEEVEATGAQIILGNTFHLWLRPGQEIMKLHGDLHDFMQWKGPILTDSGGFQVFSLGDIRKITEQGVHFRNPINGDPIFLDPEKSMEIQYDLGSDIVMIFDECTPYPADWDYAKRSMEMSLRWAKRSRERFDSLGNKNALFGIIQGSIYEDLRDISVKGLVDIGFDGYAVGGLAVGEPKADMHRILEHVCPQIPADKPRYLMGVGKPEDLVEGVRRGIDMFDCVMPTRNARNGHLFVTDGVVKIRNAKYKSDTGPLDPECDCYTCRNYSRAYLHHLDRCNEILGARLNTIHNLRYYQRLMAGLRKAIEEGKLESFVTDFYQRQGREVPPLNVD

tgt

Queuine tRNA-ribosyltransferase

375 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

42.608 kDa

MKFELDTTDGRARRGRLVFDRGVVETPCFMPVGTYGTVKGMTPEEVEATGAQIILGNTFHLWLRPGQEIMKLHGDLHDFMQWKGPILTDSGGFQVFSLGDIRKITEQGVHFRNPINGDPIFLDPEKSMEIQYDLGSDIVMIFDECTPYPADWDYAKRSMEMSLRWAKRSRERFDSLGNKNALFGIIQGSIYEDLRDISVKGLVDIGFDGYAVGGLAVGEPKADMHRILEHVCPQIPADKPRYLMGVGKPEDLVEGVRRGIDMFDCVMPTRNARNGHLFVTDGVVKIRNAKYKSDTGPLDPECDCYTCRNYSRAYLHHLDRCNEILGARLNTIHNLRYYQRLMAGLRKAIEEGKLESFVTDFYQRQGREVPPLNVD

tgt

Queuine tRNA-ribosyltransferase

375 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

42.594 kDa

MKFELDTTDGRARRGRLVFDRGVVETPCFMPVGTYGTVKGMTPEEVEATGAQIILGNTFHLWLRPGQEIMKLHGDLHDFMQWKGPILTDSGGFQVFSLGDIRKITEQGVHFRNPINGDPIFLDPEKSMEIQYDLGSDIVMIFDECTPYPADWDYAKRSMEMSLRWAKRSRERFDSLGNKNALFGIIQGSVYEDLRDISVKGLVDIGFDGYAVGGLAVGEPKADMHRILEHVCPQIPADKPRYLMGVGKPEDLVEGVRRGIDMFDCVMPTRNARNGHLFVTDGVVKIRNAKYKSDTGPLDPECDCYTCRNYSRAYLHHLDRCNEILGARLNTIHNLRYYQRLMAGLRKAIEEGKLESFVTDFYQRQGREVPPLNVD

tgt

Queuine tRNA-ribosyltransferase

375 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

40.786 kDa

MKPRFAFSISATDGAARAGVIAMQRGEIRTPAFMPVGTAATVKAMRPAEVRAAGADIILGNTYHLMLRPTAERMARFGGLHKFMGWDRPILTDSGGYQVMSLSALTKQSEEGVAFKSHLDGSRHMLTPERSMEIQRLLGSDIVMAFDECPPAGVDARRAEASMERSMRWAARSRAGFDAGEEHAARSALFGIQQGSLDEKLRARSAATLIDIGFDGYAIGGLAVGEGQAAMFGVLDFAPAQLPADRPRYLMGVGKPDDLVGAVARGVDMFDCVLPTRSGRNGQAFTWDGPLNIRNAKFADDQEPLDASCGCPVCTIWSRGYLHHLVRAGEMLGAMLMTQHNIHFYQDLMQAMRDAITTGRFAAFRSDFAARYRRA

tgt

Queuine tRNA-ribosyltransferase

375 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

42.223 kDa

MLNFKLLNTDGNARRGQLTVNHGVIETPIFMPVGTYGSVKAMSPLELKEIDAQIILGNTFHLWLRPGNDIVAKFGGLHEFMGWDKPILTDSGGFQVFSLGEMRKITEEGVHFSSPINGDKLFLSPEVSMQIQRVLNSDIVMQFDECTPYEIDGRPATADEAAKSMRMSLRWAKRSIDEFNREENPNALFGIVQGGMFEHLRDESLAGLEDINFHGVAIGGLSVGEPKEDMLRVLQHVGPRLPANKPHYLMGVGTPEDLVQGVANGIDMFDCVMPTRNARNGWLFTRFGDIKIKNARYKDDKKPLDASCGCYACRNFSRAYLHHLHRTGEILGARLNTIHNLHYYLDLMREMREAISEGRFQLFVKQFHADRARGA

tgt

Queuine tRNA-ribosyltransferase

375 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

42.301 kDa

MLNFKLLKTDGNARRGQLTLNHGVIETPIFMPVGTYGSVKAMSPLELNEIDAQIILGNTFHLWLRPGNDIIAKFGGLHEFMGWNKPILTDSGGFQVFSLGEMRKITEEGVHFSSPINGDKLFLSPEVSMQIQRVLNSDIVMQFDECTPYEIDGRPATTEEAAKSMRMSLRWAKRSMDEFNREENPNALFGIVQGGMFENLRDESLAGLEELNFHGVAIGGLSVGEPKEDMMRVLEHVGPRLPANKPHYLMGVGTPEDLVAGVASGIDMFDCVMPTRNARNGWLFTRFGDIKIKNARYKDDKKPLDESCSCYACRNFSRAYLHHLHRTGEILGARLNTIHNLHYYLDLMREMREAISEGRFQLFVSQFHADRARGS

tgt

Queuine tRNA-ribosyltransferase

375 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

42.568 kDa

MKFELDTTDGRARRGRLVFERGVVETPAFMPVGTYGTVKGMTPEEVEATGAQIILGNTFHLWLRPGQEIMKLHGDLHDFMQWKGPILTDSGGFQVFSLGDIRKITEQGVHFRNPINGDPIFLDPEKSMEIQYDLGSDIVMIFDECTPYPADWDYAKRSMEMSLRWAKRSRDRFDSLGNKNALFGIIQGSVYEDLRDISVKGLVEIGFDGYAVGGLAVGEPKEDMHRILEHVCPQIPADKPRYLMGVGKPEDLVEGVRRGIDMFDCVMPTRNARNGHLFVTDGVVKIRNAKHKSDTAPLDAECDCYTCRNYSRAYLHHLDRCNEILGARLNTIHNLRYYQRLMAGLRKAIEEGKLESFVTDFYQRQGRTVPPLNVD

tgt

Queuine tRNA-ribosyltransferase

375 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

42.98 kDa

MAAIKYRLIKKDSRTNARLGILETPHGIIETPVFMPVGTQATVKSMTPEELKEIGATIILSNTYHLYLRPGHKIIEKAGGLHKFMNWDRAILTDSGGFQVFSLNSLRKITEDGVEFRSHIDGSRHFFTPEKVIEIQNALGSDIMMSFDECAPYPADYDYVKKSMELTIKWAERGKRAHKNTEKQALFGIVQGGTYEDLRKECAQRLVDMDFPGYSIGGLSVGEPKNVMYDIVDLTTEYLPEDKPRYLMGVGSPDDLIEGVIRGVDMFDCVLPTRIARNGTVFTSKGKLIVRDAPYAEDFSPLDEECDCYTCRNYSRAYIRHLFKANEILAARLATIHNLYFLIKLMERIREAIRQDRLLEFKKQFFKKYGYKEEY

tgt

Queuine tRNA-ribosyltransferase

375 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

42.93 kDa

MAAIKYRLIKKDSRTNARLGILETPHGVIETPVFMPVGTQATVKAMTPEELKEIGATIILSNTYHLYLRPGHKIIEKAGGLHRFMNWDRAILTDSGGFQIFSLSSLRKIKEEGVEFRSHIDGSKHFFTPEKVIEIQNALGSDIIMSFDECAPYPADYEYVKNSMELTIKWAERGKKAHKNTEKQALFGIVQGGIYEDLRKECAQRLVEMDFPGYSIGGLSVGEPKNVMYDIVDLTTEYLPENKPRYLMGVGSPDDLIEGVIRGVDMFDCVLPTRIARNGTVFTSKGKLIVRDAPYAEDFSPLDEECDCYTCKNYSRAYIRHLFKANEILAARLATIHNLYFLIKLMERIREAIRQDRLLEFKKQFFKKYGYKEEY

tgt

Queuine tRNA-ribosyltransferase

375 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.

41.191 kDa

MTTPGTFEIHATDGAARTGCLHTAHGIVRTPIFMPVGTVGSVKAIAPDDLEAIGAEIILGNTYHLYLRPGDELVARRGGLHEFNAWRKPILTDSGGFQVFSLSGLRRIAEEGVEFRSHLDGSKHLFTPEKVVSIQRNLNSDIMMVLDECVPYGADRTYTEKSVGLTTRWAKRCRDAYPKGAAGNLLFGITQGGFFKDLRTRSIGALTDIDFDGFALGGLSVGEPKAEMMDLLYHSAPLLPADKPRYLMGVGTPLDIINGIAAGVDMFDCVLPTRNARNGTLYTSLGKLNIKRREFAEDDGPLDPACSCYTCRTFSRAYLRHLYTAKELLAFRLNSIHNLTYFLDLVRGARAAIAAGRFAEYKRSFEAIYPEEVVA

tgt

Queuine tRNA-ribosyltransferase

375 amino acids

Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).

Belongs to the queuine tRNA-ribosyltransferase family.