About Products Protein Database Contact

Protein expression services for tgt | Queuine tRNA-ribosyltransferase

Description
Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).
Family
Belongs to the queuine tRNA-ribosyltransferase family.
Species
Pediococcus pentosaceus (strain ATCC 25745 / CCUG 21536 / LMG 10740 / 183-1w)
Length
380 amino acids
Sequence
MEPAIKYRLIKTDKHTGARLGEIITPHGTFPTPIFMPVGTQATVKAMSPEELEDLGADIILSNTYHLWVRPGEDIVKEGGGLHQFMNWKKGILTDSGGFQVFSLAKLRDITEEGVHFKNELNGANMFLSPEKAIQIENDLGPDIMMSFDECPPYFESYDYVKHSVERTSRWAERGLKAHRNPETQGLFGIIQGAGFEDLRRQSAKDLVSMDFPGYSIGGLSVGESKEEMNRVLDFTTQLIPENKPRYLMGVGSPDALIDGVLRGVDMFDCVLPTRIARNGTCMTSHGRLVVKNAKYARDFTPIDDNCQCYTCRNYTRAYIRHLIKTDETFGLRLTSIHNVYFLVHLMKDVRQAIMDDNLLEFRQNFFEEYGYNKENSKNF
Mass
43.2 kDa
Simulated SDS-PAGE
Western blot of tgt recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make tgt using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here