Description
Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr). Catalysis occurs through a double-displacement mechanism. The nucleophile active site attacks the C1' of nucleotide 34 to detach the guanine base from the RNA, forming a covalent enzyme-RNA intermediate. The proton acceptor active site deprotonates the incoming PreQ1, allowing a nucleophilic attack on the C1' of the ribose to form the product. After dissociation, two additional enzymatic reactions on the tRNA convert PreQ1 to queuine (Q), resulting in the hypermodified nucleoside queuosine (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).
Family
Belongs to the queuine tRNA-ribosyltransferase family.
Species
Helicobacter pylori (strain G27)
Sequence
MDFQLQAIDKHARAGLLNLAHSQVATPVFMPVGTQGCIKSLDAMDMQEILGAKLILANTYHMYLRPGEKVVEQLGGLHRFAQFHGSFLTDSGGFQAFSLSGNVKLQEDGIVFKSHIDGSKHFFTPAKVLDIQYSLNSDIMMVLDDLVGLPAPLKRLEESIKRSAKWANLSLEYHKEKNRPNNNLFAIIQGGTHLKMRSLSVELTHKGFDGYAIGGLAVGESVDEMLETIAHTAPLLPKDKPRYLMGVGTPENILDAISLGVDMFDCVMPTRNARNATLFTHSGKISIKNAPYKLDNTPIEENCACYACKRYSKAYLHHLFRAKELTYARLASLHNLHFYLEMVKNARNAILEKRFLSFKKEFLEKYHSCSH
Simulated SDS-PAGE

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service