rsgA

Small ribosomal subunit biogenesis GTPase RsgA 1, mitochondrial

433 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit (By similarity). Required for embryo development (PubMed:15266054).

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

49.155 kDa

MLRAKHIGKNYSSSLSPVLSPEHKPSLLESQAIGTVATAQANFMRVIVQDVANSVTSDDDNDSSKTGVELLCVVRAVLKKIRRRVLVGDKVLVGSIDWVDRRGMIENVFHRRSEILDPPVANVDHLLVLFSLDQPKLEPFTLTRFLVEAESTRIPLTLALNKTELISEEELETWKIRLRGWNYEPLFCSVGTKDGLDDIAFVLRDQTSVIVGPSGVGKSSLINVLRSNHGGGVVEDENWFEPMLGNKWFDDQRVGEVSSRSGRGKHTTRNVSLLPVSEGGYLADTPGFNQPSLLKVTKHSLAHCFPEIRNMIESEKCGFRDCLHIGEPGCVVKGDWERYPYYLQLLDEIRIREEFQLRTFGTKREDDVRYKVGDMGVKHAEPRLMPKKHRRESRKKTKQTMISELDEFEDEDSDLYIENDPIVQAIENENKRQ

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

387 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

42.941 kDa

MTKKKKLTHGQVRRVRNNQHKKLKQEESIVWDEALLGSAQPGLVITRFGQHADIEDPVTGEIHRCNLRRGIESLVSGDNVLWRPGAETLAGISGVVEAVEARSSVLVRPDYYDGLKPVAANVDQMVIVSSVLPELSLNIIDRYLIASETLGIAPLIVLNKIDLLSPELREQYSTWLNDYRAIGYDVLYVSKKTGEGIADLEVKLRDRTNVFVGQSGVGKSSLVNALLPELEEDVEEGAISETSGLGQHTTTAARLYHIPSGGDLIDSPGVREFGLWHLETDDVTKAYVEFRPYLGGCKFRDCKHGDDPGCLLREAVSKGEISALRFDNYHRIVQSMTENKANRQYSRSKKPICKSKLLASLEHLLTEGAIFSNISRPSPLYWNVNHG

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

370 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

41.503 kDa

MRVFTTGQLLGTVVAVQANFYKVQLDQDVREPGSRGAGEEVHLDSPLPLYPLSLLLCTRRTRLKKIGQQVMVGDRVVVEEPDWAGGRGAIAEVLSRQTQLDRPPIANADQILLVFAVADPPLEPYQLSRFLVKAETTGLDVVLCLNKSDLVSPEIQQQISDRLLAWGYQPLFISVEKQINIDQIAKYLSNKITVVAGPSGVGKSSLINALIPDINLRVGEVSGKLARGRHTTRHVELFELPNGGLLADTPGFNQPDVDCSPEELVHYFPEARERLAVASCRFNDCLHRDEPDCAVRGDWERYEHYLEFLADAIARQTQLYQQADPESTLKLKTKGKGQSQYEPKLESKKYRRTSRRTQVQGLQDLYQEEE

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

370 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

39.458 kDa

MSLSSLPGSFSSSSHPLVPYGWDADWEAEFAPYDSEGLLAGRVIRVDRGQCDVVTPGGMLRADTAFVTPHDPMRVVCTGDWVAVEPAGDPRYVRTYLPRRSAFVRSTSSKRSEGQILAANVDYAVVAVSLAVELDLGRVERFLALAWESGAQPVVVLTKADLVPDATTLSYLVQDVETAAPGVPVLSVSSNLGEGLDVLAAVLSGGTSVLLGQSGAGKSTLANALLGEDVMKVHATRDVDGKGRHTTTTRNLLALPGGGVLIDTPGLRGVGLWDAETGVNQVFSEIEALAAECRFHDCAHTAEPGCAVLAALDTGELPERRLDSYRKLLRENQRIVAKTDARLRAEIRRDWKRKGAEGKAAMEAKRGQWG

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

369 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

40.109 kDa

MNNHSETESSGHNSVHGNNDNIPGWNEELELAFSAYKGLYLAGRISSRHKTVCEVLVPGAVVQAGISGALQRIGKQPVVGDFVVLLDQPETGSRMVVNILPRRTCLSRGAAGDGGGEQLIAANLDTIFIVTSVGKDLNLRRLERYLAIVYSSGASPVILLNKIDLADDPARLVEKIRDVTGDVPVIPLSALSKTGLDALGPYLNPGETVALVGSSGVGKSTLINAFLGETVQKTADIRKDDEKGRHTTTVRQMFLLPNGAVLIDNPGIREIQLGDSAEGLEKAFSEIVDAARNCKFKDCTHRNEPGCAVLQAVRDGIIPEERLESYHRLTDELSFQSKKAEIGLKRLEKERYREMAVNIKKYRKFTGKP

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

369 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

41.891 kDa

MTKATDEGTVIAVQANYYWVRLRNVTSQPLLCTRRTRLKKVGQKVMVGDQVRVELPPSLLLHGRSNTAPVPMVAEGDLGAIAKVYPRRTVLERPPVANAEQICLVFALTDPPLEEWQLSRFLVQAEATGLEISLCFNKQDLVQETDVKFWGDRLAAWGYAPIIISVENRWGVEKLQEKLRSRISLMAGPSGVGKSSLINLLVPGVEQQVKNVSGKLRKGRHTTRHVELFDLPHGGLLADTPGFNQPDLAVEPAQLIHLFPEARQQLTGQECFFKDCLHRGEPDCAVGQDWERYEHYLTFLEEVLAQQNPENSRETDTGLKTKTGSDGQEYDEPKLETKKYRRHSRRQEHQELQSFCEQTDLDNLQEDWE

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

367 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

39.819 kDa

MTLSSLGWDDFFAGAFQPFASENFLPARVALEHKHACVLLSARGEITATCTGRLLHETATRAALPAVGDWVAVRLRPESLASGAGVALVGDIHAVLPRRTAFTRRAVGDADAEQVLATNVDTVFLVTGLDRDFNLRRIERYLAVARASEAQPVVVLNKSDLHPDARGAEAEVRRITRTAPVVTLSAARGDGIAALAPWLVPGATVALLGSSGAGKSTLINRLLGKQRQDTGPLSHAMNKGRHTTTHRELLALPGGALVIDTPGLRELQLWGVDESAVAETFPEVAALAAECRFPDCTHQREPGCAVRAALDDGTLDPTRWASYEKLQREQAYAARRVDPVLARAERDRWKKIYQGQRARERIEGRWE

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

366 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

38.724 kDa

MTSTSSHSNHSALSSYGWDDSWADAFAPYAAEGLLPGRVVRVDRGQCDVVTADGVLRADTAFVTPHDPLRVVCTGDWVAVEPGGNPRYVRTYLPRRTAFVRSTSSKRSEGQILAANVDHAVVAVSLAVELDLARIERFLALAWESGAQPLVVLTKADLVPDPVTLAYLVQDVETAAPGVPVLPVSAEQGEGLDVLAAVVSGGTAVLLGQSGAGKSTLANALLGEAAMDVQAIRDVDGKGRHTTTTRNLLALPGGGVLIDTPGLRGVGLFDAGNGVDQVFAEIAELAEECRFHDCAHESEPGCAVLAAIDSGALPERRLESYRKLMRENQRIVAKTDARARAEIRKEYKRRGAIGKAAMEAKRGGLR

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

365 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

39.319 kDa

MNNHSEAESSGHGDNDTIPGWNEELELAFSAYKGSYVPGRVASRHKTVCDVLLPAAVVQAGISGALQKIGKQPVVGDFVVVLDQPELGSRMIVNILPRKTCLSRGAAGDGGGEQVIAANIDTIFIVTATGKDLNLRRLERYLAIVYSSGARPVILLNKIDLEDNPIRLVEKIQSIAGNVPVIPLSALSKTGLEALSPHLNPGETVALVGSSGVGKSTLINSLLGETVQRTGGIREDDEKGRHTTTVRQMFLLPNGAVLIDNPGIREIQLGDSAEGIEKAFSEIVDAASNCKFKDCTHRDEPGCAVLKAVKDGIIPEERLASYHRLTDELAFQSRKSEIGLKRLEKERFKKIAVDIKKYKKSTGKL

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

364 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

39.384 kDa

MNIKQLGWNAHFESHFENYRGQDLVPARVIRVGGGFYTLLGADGEQTATLAGQLRHGSTQDALPAVGDWVGIDSPQEGGIRIHAILPRQTALKRATVSNRKGLVEKPGVPQVLAANVDIAIIVCGLNRDYNPRRIERYLTLVHESGAMPLIVLNKSDICPETQARRAEIESIAFGTPVLVTSAQCGDGLDELASHLKAGSTLVLIGSSGAGKSTLLNRLACAEHQQTSEISAAVGKGMHTTTHRELFPLPGGALVIDTPGLRELHLWGESEAGLASTFPEVIGFAAQCRFSDCQHDQEPDCGIRQALHDGTLDPARLESYLKQRAEIASATLQSELAAQVAQKRKRKTIPRQGKRWRREHGDGQ

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

363 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

39.113 kDa

MSDTPPDYPTLQSIGWPWPGPPEEAAWQAIFAAHPQALPARVVEQHRTGYVAADTPQASVKAESLPEWQRPRFPSHERAAVGDWVLMEGKRIVALLPRRTSIKRGAAGEHYHQQVIAANIDTVFIVCGLDADFNPRRIERYLLLVGGGGAQPVVVLTKADQTEYAEDALAVLEELEAQNIPLRAVNAKDPDSVAALRPWLGDGRTAVLVGSSGAGKSTLTNTLLGTQKMKTNAVRENDSRGRHTTTHRALIPLPSGACLIDTPGMRELKPTGEEDLAEGGFSDVEALAAQCRFNDCAHIAEPGCAVRAAIDAGELDPERVANYMKLRVEVASAAEKLATRVAQNNRGKGSGKRPASVDRPGRR

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

363 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

39.257 kDa

MSDTSPNYHTLQSIGWPWPGPPEDPAWQAIFAAHPQALPARVVEQHRTGYVVADTPEASLKAESLPEWQRPRFPSHERAAVGDWVLMEGKRIVALLPRRTSIKRGAAGEHYHQQVIAANIDTVFIVCGLDADFNPRRIERYLLLVGGGGAEPVVVLTKADQTEYAEDALAVLEELEAQNIALRAVNAKDPESVAALRPWLGDGRTAVLVGSSGAGKSTLTNTLLGTQKMKTNAVRENDSRGRHTTTHRALIPLPSGACLIDTPGMRELKPTGEEDLAEGGFSDVEALAAQCRFNDCAHIAEPGCAVRAAIEADQLDPERVANYMKLRVEVASAAEKLATRVAQNNRGKGSGKRPASVDRPGRR

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

363 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

39.257 kDa

MSDTSPNYHTLQSIGWPWPGPPEDPAWQAIFAAHPQALPARVVEQHRTGYVVADTPEASLKAESLPEWQRPRFPSHERAAVGDWVLMEGKRIVALLPRRTSIKRGAAGEHYHQQVIAANIDTVFIVCGLDADFNPRRIERYLLLVGGGGAEPVVVLTKADQTEYAEDALAVLEELEAQNIALRAVNAKDPESVAALRPWLGDGRTAVLVGSSGAGKSTLTNTLLGTQKMKTNAVRENDSRGRHTTTHRALIPLPSGACLIDTPGMRELKPTGEEDLAEGGFSDVEALAAQCRFNDCAHIAEPGCAVRAAIEADQLDPERVANYMKLRVEVASAAEKLATRVAQNNRGKGSGKRPASVDRPGRR

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

363 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

39.257 kDa

MSDTSPNYHTLQSIGWPWPGPPEDPAWQAIFAAHPQALPARVVEQHRTGYVVADTPEASLKAESLPEWQRPRFPSHERAAVGDWVLMEGKRIVALLPRRTSIKRGAAGEHYHQQVIAANIDTVFIVCGLDADFNPRRIERYLLLVGGGGAEPVVVLTKADQTEYAEDALAVLEELEAQNIALRAVNAKDPESVAALRPWLGDGRTAVLVGSSGAGKSTLTNTLLGTQKMKTNAVRENDSRGRHTTTHRALIPLPSGACLIDTPGMRELKPTGEEDLAEGGFSDVEALAAQCRFNDCAHIAEPGCAVRAAIEADQLDPERVANYMKLRVEVASAAEKLATRVAQNNRGKGSGKRPASVDRPGRR

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

363 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

39.073 kDa

MSDISPDYPTLQSIGWPWPGPPEEAAWKAVFAAHPQALPARVVEQHRTGYVVADTPEASLKAESLPEWQRPRFPSHERAAVGDWVLMEGKRIVALLPRRTSIKRGAAGAHYHQQVIAANIDTVFIVCGLDADFNPRRIERYLLLVGGGGAQPVVVLTKADQTEHAEDALAVLEELEAQNIPLRAVNAKDPASVAALRPWLGDGRTAVLVGSSGAGKSTLTNTLLGTEKMKTNGVRENDSRGRHTTTHRALIPLPSGACLIDTPGMRELKPTGEEDLAEGGFSDVEALAAQCRFNDCAHIAEPGCAVRAAIEADLLDPERVANYMKLRVEVASAAEKLATRVAQNNRGKGSGKRPASIDRPGRR

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

363 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

39.087 kDa

MSDISPDYPTLQSIGWPWPGPPEEAAWKAVFAAHPQALPARVVEQHRTGYVVADTPEASLKAESLPEWQRPRFPSHERAAVGDWVLMEGKRIVALLPRRTSIKRGAAGAHYHQQVIAANIDTVFIVCGLDADFNPRRIERYLLLVGGGGAQPVVVLTKADQTEHAEDALAVLEELEAQNIPLRALNAKDPASVAALRPWLGDGRTAVLVGSSGAGKSTLTNTLLGTEKMKTNGVRENDSRGRHTTTHRALIPLPSGACLIDTPGMRELKPTGEEDLAEGGFSDVEALAAQCRFNDCAHIAEPGCAVRAAIEADLLDPERVANYMKLRVEVASAAEKLATRVAQNNRGKGSGKRPASIDRPGRR

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

363 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

39.073 kDa

MSDISPDYPTLQSIGWPWPGPPEEAAWKAVFAAHPQALPARVVEQHRTGYVVADTPEASLKAESLPEWQRPRFPSHERAAVGDWVLMEGKRIVALLPRRTSIKRGAAGAHYHQQVIAANIDTVFIVCGLDADFNPRRIERYLLLVGGGGAQPVVVLTKADQTEHAEDALAVLEELEAQNIPLRAVNAKDPASVAALRPWLGDGRTAVLVGSSGAGKSTLTNTLLGTEKMKTNGVRENDSRGRHTTTHRALIPLPSGACLIDTPGMRELKPTGEEDLAEGGFSDVEALAAQCRFNDCAHIAEPGCAVRAAIEADLLDPERVANYMKLRVEVASAAEKLATRVAQNNRGKGSGKRPASIDRPGRR

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

363 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

39.147 kDa

MSDTSPDYPTLQSIGWPWLGPPEEAAWQAVFAAHPQALPARVVEQHRTGYVVADTPEASVKAESLPEWQRPRFPSHERAAVGDWVLMEGKRIVALLPRRTSIKRGAAGEHYHQQVIAANIDTVFIVCGLDADFNPRRIERYLLLVGGGGAQPVVVLTKADQTEYAEDALAVLEELEAQNIPLRAVNAKDPDSVAALRPWLGDGRTAVLVGSSGAGKSTLTNTLLGTQKMKTNAVRENDSRGRHTTTHRALIPLPSGACLIDTPGMRELKPTGEEDLAEGGFSDVEALAAQCRFNDCAHIAEPGCAVRAAIDAGELDPERVANYMKLRMEVASAAEKLATRVAQNNRGKGSGKRPASVDRPGRH

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

359 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

39.938 kDa

MSQPNSILMSYGWDPSIYLEEPKLLEGLKPGRVLAVYGEYSKIIIEQGEKKGIFSGALMASGESIVTGDWVLIREIEGDELCIVEKILPRKTFLRRSNPGKRKGSQAIASNIDLLLVIMGLDNDYSPRRIERYLFLAKVSGAQVTIVLNKKDLCMDPENKFMEIKMIAGETPIEMISALDLKQTRTILQWIDPGKTIAFLGSSGAGKSTIINSLLGGEIQKTNEVKVSDGTGKHTTTRRELFLLPSGGVLMDNPGIREVGLFSEGSEDELEEVFPEIAVAAEECRFNDCSHNEEPNCGVVAAVKDGRISEARYFSYLKLSKELMAYQALNDPEEARKKKQKDKQMSKALQKRLKDKGRK

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

359 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

39.938 kDa

MSQPNSILMSYGWDPSIYLEEPKLLEGLKPGRVLAVYGEYSKIIIEQGEKKGIFSGALMASGESIVTGDWVLIREIEGDELCIVEKILPRKTFLRRSNPGKRKGSQAIASNIDLLLVIMGLDNDYSPRRIERYLFLAKVSGAQVTIVLNKKDLCMDPENKFMEIKTIAGETPIEMISALDLKQTRTILQWIDPGKTITFLGSSGAGKSTIINSLLGGEIQKTNEVKVSDGTGKHTTTRRELFLLPSGGVLMDNPGIREVGLFSEGSEDELEEVFPEIAVAAEECRFNDCSHNEEPNCGVVAAVKDGRISEARYFSYLKLSKELMAYQALNDPEEARKKKQKDKQMSKALQKRLKDKGRK

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

358 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

40.531 kDa

MVDAQLTDLYGTVVAVQANFYQVRLDSAVMGENLLCTRRARLQKIGQSVMVGDRVRVEEANFGDQQGAIAEVLPRSTEIDRPAVANIEQILLVFALAEPVLDPWLISRFLVKAESTGLEIAVCVNKIDLGEPEQIEVWGDRLAGWGYRPFFVSVEKNRGFEALLAQLNHKITLLAGPSGVGKSSLINCLIPEINQRVGDVSGKLQKGRHTTRHVQLFALPNRGLLADSPGFNQPDINCLPEELTFYFPEVRARLALGNCQFNDCTHRREPNCVVRGDWERYQHYLEFLEEAIAREQSLQKTSTKESSLKLKIKEAGQETYEPKLANKKYRRPSRRGKNQDQERYENKTLQDIYNDDSE

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

354 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

38.831 kDa

MSKKKPLSQGQLRRMRANHEKRLNRDSGDKNTPELQDSSLGPEQSGTVISRFGQHADIETEDGHIVRCNIRRTITSLVTGDKVIVRLAIESQANSGIAGIVEAVHPRHSSLSRPDLYDGVKIIASNIDQILIVSSVLPSFTTQIIDRYLVAAEDTDIPPIIILNKIDLLTPEEAPAIEEALKRYQDIGYPVYKVSSKLGEGLETIKALLKDKVSVFAGQSGVGKSSLVNALLPEAELLVGDVSDNSGLGQHTTTTAKLLHLPSGGDLIDSPGVREFALWHLPAQRVGWCFIEFRDFLGGCKFRDCKHGDDPGCALKAAVDAGKISEDRFNNYHRIIASLDEQRHARQFRAQSDE

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

353 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

39.452 kDa

MSKNKLSKGQQRRVSANHDRRLKQRADKPEPDDNLFGEVRDGVAISRFGMHADVEDADGSVHRCNIRRTIRSLVTGDRVRWRPGVEGGATVKGIVEAVHERTSVLTRPDFYDGVKPIAANINQIVIVSAILPELSLNIIDRYLVASETLNVEPLLVLNKTDLLDDEGREFVDEQMEIYRHIGYRVLMVSSHKKEGLRELEEALIGRVSIFAGQSGVGKSSLLNALLGLELGDEEILTKDVSDVSGLGQHTTTAARLYHFPHGGDVIDSPGVREFGLWHLEPEQITRGFVEFRDYLGGCKFRDCKHDTDPGCAIREAVDKGEIDASRFVNYHHILESMSEVQAKTRRSFSADKE

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

353 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

39.382 kDa

MSKNKLSKGQQRRVNANHQRRLKTTAEKADYDDNLFGETSEGIVISRFGMHADVESADGSVHRCNIRRTIRSLVTGDRVVWRPGKDAADGVNVKGIVEAVHERASVLTRPDFYDGVKPIAANIDQIVVVSAILPELSLNIIDRYLVACEAQDIEPLIVLNKIDLLDDDGLRFVNEQMDIYRNIGYRVLMVSSRTQDGLKPLEAALTDRISIFAGQSGVGKSSLLNALLGLNEDQILTNDVSDVSGLGQHTTTAARLYHFPHGGDVIDSPGVREFGLWHLEAEQITHGFVEFHDYLGHCKYRDCKHDNDPGCALREAVENGKIAESRFENYHRILESMEQVQVKTRKNFSSSDD

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

353 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

39.235 kDa

MSKNKLSKGQQRRVKANHQRRLKTTAEKADYDDNLFGETSEGIVISRFGMHADVESADGSVHRCNIRRTIRSLVTGDRVVWRPGKDAADGVSVKGIVEAVHDRASVLTRPDFYDGVKPIAANIDQIVVVSAILPELSLNIIDRYLVACEAQDIEPLIVLNKIDLLDDDGLRFVNEQMDIYRNIGYRVLLVSSRTQDGLKPLEAALTDRISIFAGQSGVGKSSLLNALLGLSEDQILTNDVSDVSGLGQHTTTAARLYHFPHGGDVIDSPGVREFGLWHLEAEQITNGFVEFHDYLGRCKYRDCKHDTDPGCALREAVENGKIAESRFENYHRILESMAQVQVKTRKNFSSSDD

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

352 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

40.173 kDa

MTKRKLTQNQKRRIHSNNVKALDRHHRRAKKEIDWQEEMLGDTQDGVVVTRYSMHADVENSQGEIFRCNLRRTLANVVVGDHVVWRRGHEKLQGISGVIEAIKPRENEIARPDYYDGLKVMASNIDRIIIVSSVLPALSLNIIDRYLVICENANIPAVILLNKVDLLTDEQWREAEEQLEIYRKIGYETLMISAISGKNMEKLTALLADGTSIFVGQSGVGKSSLINYILPEVNAQTGEISETSGLGQHTTTSSRLYHLPQGGNLIDSPGIREFGLWHLEPAQITNGYREFQYFLGTCKFRDCKHIDDPGCALREAVELGKIHPVRFDNYHRLISSREENKSQRHFMEQDIR

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

352 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

39.435 kDa

MTKRKLSKGQQRRVQENHKKRLQSKEKKNHVELDDTQLGEATEGLVISRFGQHADIEAADGSITRCNIRRTISSLVTGDRVVWRPALQTQENVRVNGIVEAVHERTSVLTRPDYYDGIKPIAANIDQIIIVSAILPELSLNIIDRYLVACETLNIEPLIVLNKVDMLDAESRAMVSEWMQIYKDIGYRVLEVSSYTKEGLEALTQALIGRISIFAGQSGVGKSSLLNTLLPPMEESILVNQVSDNSGLGQHTTTASRLYHFPLGGDVIDSPGVREFGLWHLTPEQVTKGFIEFRPFLGGCKFRDCKHNDDPGCLITEAVDKGEIAPTRFENYHRILESMSQVKVRKNINLDS

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

352 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

40.061 kDa

MKKNKLSKNQHRRIQAHHQYRLHPTSLTDDKNNQLDDAQFGEPQQGVVISRFGQHADVEGHQGQQQRCHIRRNVLSLVTGDRVIWRPGIPRQENRNVKGIVEAVHERKSVLTRPDFYDGIKPMAANIDQIVIVSAVIPDLSLNMIDRYLVVSESLNIKPLLLLNKIDLLTPNERKKINLRLNIYRNIHYTVLEVSAQTGEGIADLQANLLDRVSIFSGQSGVGKSSLLNTLLPPTEQQILVEALSEKSALGQHTTTTSRLYHFQQGGDLIDSPGIREFGLWHLTQEQIIQGFIEFRDYVGHCKFRDCAHIDDPCCALRDAVQKGHIAKERFDNYHQILSEITLKGKKLFNQD

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

352 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

38.932 kDa

MAKRKLNRRQRWRIEKIQAEKRDRANRRTDQQEILVADDLGDEQHGVITAHFGQQVEVESADGPGAENRTTRRCHFRATLEQLVVGDKVIWQPPKSEGLGVVVAIEPRDTVLKRPDMYGNLKPVAANVEQMLVVFAPLPTPSSSLLDRYLVAAELSGIAATLVLNKADLIDDTLRPFVDELSDMYRHLGYPVLEVCAHQREGLTPLHEALAGKTSVFVGQSGVGKSSLINGVLPEADLQVGELSSNSGLGQHTTVTARLVHLPTGGQLIDSPGIREFGLWHIGEDDLLHGYRELSELAGYCKFRNCSHRNEPGCALILAAQNGDIDEERLANFYQISDTLNEDGRERYSTDS

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

351 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

39.771 kDa

MAKHKLSKGQQRRVRENHQRRLKKQDNKPEMDDNQLGEPQEGLVISRFGQHADVEAEDGSTQRCNIRRTIRSLVTGDRVVWRPSLQTQADVKVNGIVEAVHERTSVLTRPDYYDGIKPIAANIDQIVIVSAILPELSLNIIDRYLVACETLGIEPLIVLNKIDLLDEESRAWVNEIMSTYHNIGYRVLKLSSHTGEGMEELTKMLAGRITIFAGQSGVGKSSLLNTLLPEDEEEILVNQVSDVSGLGQHTTTASRLYHFPHGGDVIDSPGVREFGLWHLTSEQVTQGFVEFRDYLGGCKFRDCKHRDDPACALRKAVEDNEINQERFENYHRILDSMDQIKPRKTFTDNDS

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

351 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

38.632 kDa

MAKRRLNKRQQWRIEKIQKERTVRAARKEKAVEEQAAAGELGPEQNGLVIAHYGQQLDIEALEGPESGQVFRCFVRANIDSLVTGDRVVWRPGKSKTGVIVARCERENLLQRPDNFGALKPVAANIDHIILVIAPEPEPHDNLIDRYLVASESSDIPAVILLNKTDLINDDNRDQIEALLARYQALGYEVARTSAAETAGTPAPEVEALVRNQTSVFVGQSGVGKSSIIQTLLPDELLRVGAVSESTGKGVHTTTTAKLFHLPGGGDLIDSPGIREFGLWHMTPQEVEYGFREIRPLIGLCKFRNCRHMGDPGCALDAAAEAGDISPERLKSFHRILQDMTDQQARGLKLT

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

350 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

39.089 kDa

MSKNKLSKGQQRRVQANHQRRLRTDRKPELDDSQLGDAQEGIVISRFGQHADVEAADGVQHRCNIRRTIKSLVTGDRVVWRPGLQAQEGVRVKGIVEAVHERTSVLTRPDLYDGVKPIAANIDQIVIVSAILPELSLNIIDRYLVACETLDVEPLIVLNKIDLLDADGRKFVDGMMDIYRRIGYNVLEVSSQTREGMEAFEQALAGRISIFAGQSGVGKSSLLNALLPPTDNEILVNTVSDNSGLGQHTTTAARLYHFQHGGDVIDSPGVREFGLWHLAPEQITQGFVEFRDYLGHCKFRDCSHTNDPGCALREAVEQGKIAEERFDNYHRILESMEQAKPRKTSDSDEK

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

350 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

39.092 kDa

MSKNKLSKGQQRRVQANHQRRLRTDRKPELDDSQLGDAQEGIVISRFGQHADVEAVDGTQHRCNIRRTIKSLVTGDRVVWRPGLQAQEGVRVKGIVEAVHERTSVLTRPDLYDGVKPIAANIDQIVIVSAILPELSLNIIDRYLVACETLEVEPLIVLNKIDLLDADGRKFVDGMMDIYRRIGYDVLEVSSQTREGMEAFENALTGRISIFAGQSGVGKSSLLNALLPPTDNEILVNTVSGNSGLGQHTTTAARLYHFQHGGDVIDSPGVREFGLWHLAPEQITQGFVEFRDYLGHCKFRDCSHTNDPGCALREAVEQGKIAEERFDNYHRILESMEQAKPRKTSDSDEK

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

350 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

39.092 kDa

MSKNKLSKGQQRRVQANHQRRLRTDRKPELDDSQLGDAQEGIVISRFGQHADVEAVDGTQHRCNIRRTIKSLVTGDRVVWRPGLQAQEGVRVKGIVEAVHERTSVLTRPDLYDGVKPIAANIDQIVIVSAILPELSLNIIDRYLVACETLEVEPLIVLNKIDLLDADGRKFVDGMMDIYRRIGYDVLEVSSQTREGMEAFENALTGRISIFAGQSGVGKSSLLNALLPPTDNEILVNTVSGNSGLGQHTTTAARLYHFQHGGDVIDSPGVREFGLWHLAPEQITQGFVEFRDYLGHCKFRDCSHTNDPGCALREAVEQGKIAEERFDNYHRILESMEQAKPRKTSDSDEK

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

350 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

39.092 kDa

MSKNKLSKGQQRRVQANHQRRLRTDRKPELDDSQLGDAQEGIVISRFGQHADVEAVDGTQHRCNIRRTIKSLVTGDRVVWRPGLQAQEGVRVKGIVEAVHERTSVLTRPDLYDGVKPIAANIDQIVIVSAILPELSLNIIDRYLVACETLEVEPLIVLNKIDLLDADGRKFVDGMMDIYRRIGYDVLEVSSQTREGMEAFENALTGRISIFAGQSGVGKSSLLNALLPPTDNEILVNTVSGNSGLGQHTTTAARLYHFQHGGDVIDSPGVREFGLWHLAPEQITQGFVEFRDYLGHCKFRDCSHTNDPGCALREAVEQGKIAEERFDNYHRILESMEQAKPRKTSDSDEK

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

350 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

39.092 kDa

MSKNKLSKGQQRRVQANHQRRLRTDRKPELDDSQLGDAQEGIVISRFGQHADVEAVDGTQHRCNIRRTIKSLVTGDRVVWRPGLQAQEGVRVKGIVEAVHERTSVLTRPDLYDGVKPIAANIDQIVIVSAILPELSLNIIDRYLVACETLEVEPLIVLNKIDLLDADGRKFVDGMMDIYRRIGYDVLEVSSQTREGMEAFENALTGRISIFAGQSGVGKSSLLNALLPPTDNEILVNTVSGNSGLGQHTTTAARLYHFQHGGDVIDSPGVREFGLWHLAPEQITQGFVEFRDYLGHCKFRDCSHTNDPGCALREAVEQGKIAEERFDNYHRILESMEQAKPRKTSDSDEK

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

350 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

39.092 kDa

MSKNKLSKGQQRRVQANHQRRLRTDRKPELDDSQLGDAQEGIVISRFGQHADVEAVDGTQHRCNIRRTIKSLVTGDRVVWRPGLQAQEGVRVKGIVEAVHERTSVLTRPDLYDGVKPIAANIDQIVIVSAILPELSLNIIDRYLVACETLEVEPLIVLNKIDLLDADGRKFVDGMMDIYRRIGYDVLEVSSQTREGMEAFENALTGRISIFAGQSGVGKSSLLNALLPPTDNEILVNTVSGNSGLGQHTTTAARLYHFQHGGDVIDSPGVREFGLWHLAPEQITQGFVEFRDYLGHCKFRDCSHTNDPGCALREAVEQGKIAEERFDNYHRILESMEQAKPRKTSDSDEK

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

350 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

39.092 kDa

MSKNKLSKGQQRRVQANHQRRLRTDRKPELDDSQLGDAQEGIVISRFGQHADVEAVDGTQHRCNIRRTIKSLVTGDRVVWRPGLQAQEGVRVKGIVEAVHERTSVLTRPDLYDGVKPIAANIDQIVIVSAILPELSLNIIDRYLVACETLEVEPLIVLNKIDLLDADGRKFVDGMMDIYRRIGYDVLEVSSQTREGMEAFENALTGRISIFAGQSGVGKSSLLNALLPPTDNEILVNTVSGNSGLGQHTTTAARLYHFQHGGDVIDSPGVREFGLWHLAPEQITQGFVEFRDYLGHCKFRDCSHTNDPGCALREAVEQGKIAEERFDNYHRILESMEQAKPRKTSDSDEK

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

350 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

39.092 kDa

MSKNKLSKGQQRRVQANHQRRLRTDRKPELDDSQLGDAQEGIVISRFGQHADVEAVDGTQHRCNIRRTIKSLVTGDRVVWRPGLQAQEGVRVKGIVEAVHERTSVLTRPDLYDGVKPIAANIDQIVIVSAILPELSLNIIDRYLVACETLEVEPLIVLNKIDLLDADGRKFVDGMMDIYRRIGYDVLEVSSQTREGMEAFENALTGRISIFAGQSGVGKSSLLNALLPPTDNEILVNTVSGNSGLGQHTTTAARLYHFQHGGDVIDSPGVREFGLWHLAPEQITQGFVEFRDYLGHCKFRDCSHTNDPGCALREAVEQGKIAEERFDNYHRILESMEQAKPRKTSDSDEK

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

350 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

39.092 kDa

MSKNKLSKGQQRRVQANHQRRLRTDRKPELDDSQLGDAQEGIVISRFGQHADVEAVDGTQHRCNIRRTIKSLVTGDRVVWRPGLQAQEGVRVKGIVEAVHERTSVLTRPDLYDGVKPIAANIDQIVIVSAILPELSLNIIDRYLVACETLEVEPLIVLNKIDLLDADGRKFVDGMMDIYRRIGYDVLEVSSQTREGMEAFENALTGRISIFAGQSGVGKSSLLNALLPPTDNEILVNTVSGNSGLGQHTTTAARLYHFQHGGDVIDSPGVREFGLWHLAPEQITQGFVEFRDYLGHCKFRDCSHTNDPGCALREAVEQGKIAEERFDNYHRILESMEQAKPRKTSDSDEK

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

350 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

39.714 kDa

MSKRKLTQNQKRRIQSNNEKTLHRHQRREKKEIDWQDDMLGESQDGIVVTRYSVHADVEDAAGEIFRCNLRRTLSSLVVGDRVIWRKGNAQLQGVSGVIEAIKPRQNEIARPDYYDGLKVIAANIDRIIIVSSVLPTLSLNIIDRYLVICENAQIPAVIVVNKVDLLSDQERAEVEAQLRIYQQIGYQTLMISALSGENMEKLTALFDEGTSIFVGQSGVGKSSLINHILPEVNAQVGDISENSGLGQHTTTSSRLYHLRQGGQLIDSPGIREFGLWHLDQEQITRGYREFQYFLGTCKFRDCKHLNDPGCALREAMEQGKIHSVRFANYHRLIASLEETKSQRHFSSEN

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

350 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

38.948 kDa

MSKNKLSKGQQRRVNANHQRRLKTSAEKADYDDNLFGEPAEGIVISRFGMHADVESADGEVHRCNIRRTIRSLVTGDRVVWRPGKAAAEGVNVKGIVEAVHERTSVLTRPDFYDGVKPIAANIDQIVIVSAILPELSLNIIDRYLVGCETLQVEPLIVLNKIDLLDDEGMDFVNEQMDIYRNIGYRVLMVSSHTQDGLKPLEEALTGRISIFAGQSGVGKSSLLNALLGLQNEILTNDVSNVSGLGQHTTTAARLYHFPHGGDVIDSPGVREFGLWHLEPEQITQGFVEFHDYLGHCKYRDCKHDADPGCAIREAVENGAIAETRFENYHRILESMAQVKTRKNFSDTDD

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

350 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

38.914 kDa

MSKNKLSKGQQRRVNANHQRRLKTSAEKADYDDNLFGEPAEGIVISRLGMHADVESADGEVHRCNIRRTIRSLVTGDRVVWRPGKAAAEGVNVKGIVEAVHERTSVLTRPDFYDGVKPIAANIDQIVIVSAILPELSLNIIDRYLVGCETLQVEPLIVLNKIDLLDDEGMDFVNEQMDIYRNIGYRVLMVSSHTQDGLKPLEEALTGRISIFAGQSGVGKSSLLNALLGLQNEILTNDVSNVSGLGQHTTTAARLYHFPHGGDVIDSPGVREFGLWHLEPEQITQGFVEFHDYLGHCKYRDCKHDADPGCAIREAVENGAIAETRFENYHRILESMAQVKTRKNFSDTDD

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

350 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

38.914 kDa

MSKNKLSKGQQRRVNANHQRRLKTSAEKADYDDNLFGEPAEGIVISRLGMHADVESADGEVHRCNIRRTIRSLVTGDRVVWRPGKAAAEGVNVKGIVEAVHERTSVLTRPDFYDGVKPIAANIDQIVIVSAILPELSLNIIDRYLVGCETLQVEPLIVLNKIDLLDDEGMDFVNEQMDIYRNIGYRVLMVSSHTQDGLKPLEEALTGRISIFAGQSGVGKSSLLNALLGLQNEILTNDVSNVSGLGQHTTTAARLYHFPHGGDVIDSPGVREFGLWHLEPEQITQGFVEFHDYLGHCKYRDCKHDADPGCAIREAVENGAIAETRFENYHRILESMAQVKTRKNFSDTDD

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

350 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

38.948 kDa

MSKNKLSKGQQRRVNANHQRRLKTSAEKADYDDNLFGEPAEGIVISRFGMHADVESADGEVHRCNIRRTIRSLVTGDRVVWRPGKAAAEGVNVKGIVEAVHERTSVLTRPDFYDGVKPIAANIDQIVIVSAILPELSLNIIDRYLVGCETLQVEPLIVLNKIDLLDDEGMDFVNEQMDIYRNIGYRVLMVSSHTQDGLKPLEEALTGRISIFAGQSGVGKSSLLNALLGLQNEILTNDVSNVSGLGQHTTTAARLYHFPHGGDVIDSPGVREFGLWHLEPEQITQGFVEFHDYLGHCKYRDCKHDADPGCAIREAVENGAIAETRFENYHRILESMAQVKTRKNFSDTDD

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

350 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

38.948 kDa

MSKNKLSKGQQRRVNANHQRRLKTSAEKADYDDNLFGEPAEGIVISRFGMHADVESADGEVHRCNIRRTIRSLVTGDRVVWRPGKAAAEGVNVKGIVEAVHERTSVLTRPDFYDGVKPIAANIDQIVIVSAILPELSLNIIDRYLVGCETLQVEPLIVLNKIDLLDDEGMDFVNEQMDIYRNIGYRVLMVSSHTQDGLKPLEEALTGRISIFAGQSGVGKSSLLNALLGLQNEILTNDVSNVSGLGQHTTTAARLYHFPHGGDVIDSPGVREFGLWHLEPEQITQGFVEFHDYLGHCKYRDCKHDADPGCAIREAVENGAIAETRFENYHRILESMAQVKTRKNFSDTDD

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

350 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

38.948 kDa

MSKNKLSKGQQRRVNANHQRRLKTSAEKADYDDNLFGEPAEGIVISRFGMHADVESADGEVHRCNIRRTIRSLVTGDRVVWRPGKAAAEGVNVKGIVEAVHERTSVLTRPDFYDGVKPIAANIDQIVIVSAILPELSLNIIDRYLVGCETLQVEPLIVLNKIDLLDDEGMDFVNEQMDIYRNIGYRVLMVSSHTQDGLKPLEEALTGRISIFAGQSGVGKSSLLNALLGLQNEILTNDVSNVSGLGQHTTTAARLYHFPHGGDVIDSPGVREFGLWHLEPEQITQGFVEFHDYLGHCKYRDCKHDADPGCAIREAVENGAIAETRFENYHRILESMAQVKTRKNFSDTDD

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

350 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

39.004 kDa

MSKNKLSKGQQRRVNANHQRRLKTSVEKADYDDNLFGEPAEGIVISRFGMHADVESADGEVHRCNIRRTIRSLVTGDRVVWRPGKAAAEGVNVKGIVEAVHERTSVLTRPDFYDGVKPIAANIDQIVIVSAILPELSLNIIDRYLVGCETLQVEPLIVLNKIDLLDDEGMDFVNEQMDIYRNIGYRVLMVSSHTQDGLKPLEEALTGRISIFAGQSGVGKSSLLNALLGLQNEILTNDVSNVSGLGQHTTTAARLYHFPHGGDVIDSPGVREFGLWHLEPEQITRGFVEFHDYLGHCKYRDCKHDADPGCAIREAVENGAIAETRFENYHRILESMAQVKTRKNFSDTDD

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

350 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

38.947 kDa

MSKNKLSKGQQRRVNANHQRRLKTSAEKADYDDNLFGEPAEGIVISRFGMHADVESADGEVHRCNIRRTIRSLVTGDRVVWRPGKAAAEGVNVKGIVEAVHERTSVLTRPDFYDGVKPIAANIDQIVIVSAILPELSLNIIDRYLVGCETLQVEPLIVLNKIDLLDDEGMDFVNEQMNIYRNIGYRVLMVSSHTQDGLKPLEEALTGRISIFAGQSGVGKSSLLNALLGLQNEILTNDVSNVSGLGQHTTTAARLYHFPHGGDVIDSPGVREFGLWHLEPEQITQGFVEFHDYLGHCKYRDCKHDADPGCAIREAVENGAIAETRFENYHRILESMAQVKTRKNFSDTDD

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

350 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

38.948 kDa

MSKNKLSKGQQRRVNANHQRRLKTSAEKADYDDNLFGEPAEGIVISRFGMHADVESADGEVHRCNIRRTIRSLVTGDRVVWRPGKAAAEGVNVKGIVEAVHERTSVLTRPDFYDGVKPIAANIDQIVIVSAILPELSLNIIDRYLVGCETLQVEPLIVLNKIDLLDDEGMDFVNEQMDIYRNIGYRVLMVSSHTQDGLKPLEEALTGRISIFAGQSGVGKSSLLNALLGLQNEILTNDVSNVSGLGQHTTTAARLYHFPHGGDVIDSPGVREFGLWHLEPEQITQGFVEFHDYLGHCKYRDCKHDADPGCAIREAVENGAIAETRFENYHRILESMAQVKTRKNFSDTDD

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

350 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

39.193 kDa

MSKNKLSKGQQRRVNANHQRRLKTSKEKPDYDDNLFGEPDEGIVISRFGMHADVESADGDVHRCNIRRTIRSLVTGDRVVWRPGKPAAEGVNVKGIVEAVHERTSVLTRPDFYDGVKPIAANIDQIVIVSAILPELSLNIIDRYLVACETLQIEPIIVLNKIDLLDDEGMAFVNEQMDIYRNIGYRVLMVSSHTQDGLKPLEEALTGRISIFAGQSGVGKSSLLNALLGLQKEILTNDISDNSGLGQHTTTAARLYHFPHGGDVIDSPGVREFGLWHLEPEQITQGFVEFHDYLGLCKYRDCKHDTDPGCAIREAVEEGKIAETRFENYHRILESMAQVKTRKNFSDTDD

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

350 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

39.193 kDa

MSKNKLSKGQQRRVNANHQRRLKTSKEKPDYDDNLFGEPDEGIVISRFGMHADVESADGDVHRCNIRRTIRSLVTGDRVVWRPGKPAAEGVNVKGIVEAVHERTSVLTRPDFYDGVKPIAANIDQIVIVSAILPELSLNIIDRYLVACETLQIEPIIVLNKIDLLDDEGMAFVNEQMDIYRNIGYRVLMVSSHTQDGLKPLEEALTGRISIFAGQSGVGKSSLLNALLGLQKEILTNDISDNSGLGQHTTTAARLYHFPHGGDVIDSPGVREFGLWHLEPEQITQGFVEFHDYLGLCKYRDCKHDTDPGCAIREAVEEGKIAETRFENYHRILESMAQVKTRKNFSDTDD

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

350 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

39.179 kDa

MSKNKLSKGQQRRVNANHQRRLKTSKEKPDYDDNLFGEPDEGIVISRFGMHADVESADGDVHRCNIRRTIRSLVTGDRVVWRPGKPAAEGVNVKGIVEAVHERTSVLTRPDFYDGVKPIAANIDQIVIVSAILPELSLNIIDRYLVACETLQIEPIIVLNKIDLLDDEGMAFVNEQMDIYRNIGYRVLMVSSHTQDGLKPLEEALTGRISIFAGQSGVGKSSLLNALLGLQKEILTNDVSDNSGLGQHTTTAARLYHFPHGGDVIDSPGVREFGLWHLEPEQITQGFVEFHDYLGLCKYRDCKHDTDPGCAIREAVEEGKIAETRFENYHRILESMAQVKTRKNFSDTDD

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

350 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

39.237 kDa

MSKNKLSKGQQRRVNANHQRRLKTSKEKPDYDDNLFGEPDEGIVISRFGMHADVESADGDVHRCNIRRTIRSLVTGDRVVWRPGKPAAEGVNVKGIVEAVHERTSVLTRPDFYDGVKPIAANIDQIVIVSAILPELSLNIIDRYLVACETLQIEPIIVLNKIDLLDDEGMEFVNEQMDIYRNIGYRVLMVSSHTQDGLKPLEEALTGRISIFAGQSGVGKSSLLNALLGLQKEILTNDVSDNSGLGQHTTTAARLYHFPHGGDVIDSPGVREFGLWHLEPEQITQGFVEFHDYLGLCKYRDCKHDTDPGCAIREAVEEGKIAETRFENYHRILESMAQVKTRKNFSDTDD

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

350 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

39.193 kDa

MSKNKLSKGQQRRVNANHQRRLKTSKEKPDYDDNLFGEPDEGIVISRFGMHADVESADGDVHRCNIRRTIRSLVTGDRVVWRPGKPAAEGVNVKGIVEAVHERTSVLTRPDFYDGVKPIAANIDQIVIVSAILPELSLNIIDRYLVACETLQIEPIIVLNKIDLLDDEGMAFVNEQMDIYRNIGYRVLMVSSHTQDGLKPLEEALTGRISIFAGQSGVGKSSLLNALLGLQKEILTNDISDNSGLGQHTTTAARLYHFPHGGDVIDSPGVREFGLWHLEPEQITQGFVEFHDYLGLCKYRDCKHDTDPGCAIREAVEEGKIAETRFENYHRILESMAQVKTRKNFSDTDD

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

350 amino acids

One of at least 4 proteins (Era, RbfA, RimM and RsgA/YjeQ) that assist in the late maturation steps of the functional core of the 30S ribosomal subunit (PubMed:18223068, PubMed:21102555, PubMed:21303937, PubMed:25904134, PubMed:27382067). Binds the 30S subunit contacting the head, platform, and rRNA helix 44, which may assist the last maturation stages (PubMed:21788480, PubMed:21960487). Removes RbfA from mature, but not immature 30S ribosomes in a GTP-dependent manner; 95% removal in the presence of GTP, 90% removal in GMP-PNP and 65% removal in the presence of GDP (PubMed:21102555, PubMed:25904134). Circulary permuted GTPase that catalyzes rapid hydrolysis of GTP with a slow catalytic turnover (PubMed:12220175). Dispensible for viability, but important for overall fitness. The intrinsic GTPase activity is stimulated by the presence of 30S (160-fold increase in kcat) or 70S (96-fold increase in kcat) ribosomes (PubMed:14973029). Mature 30S ribosomes stimulate intrinsic GTPase more than do immature 30S ribosomes (PubMed:25904134). Ribosome-associated GTPase activity is stimulated by RbfA (PubMed:21102555). The GTPase is inhibited by aminoglycoside antibiotics such as neomycin and paromycin (PubMed:15466596) streptomycin and spectinomycin (PubMed:15828870). This inhibition is not due to competition for binding sites on the 30S or 70S ribosome (PubMed:15828870).

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

39.193 kDa

MSKNKLSKGQQRRVNANHQRRLKTSKEKPDYDDNLFGEPDEGIVISRFGMHADVESADGDVHRCNIRRTIRSLVTGDRVVWRPGKPAAEGVNVKGIVEAVHERTSVLTRPDFYDGVKPIAANIDQIVIVSAILPELSLNIIDRYLVACETLQIEPIIVLNKIDLLDDEGMAFVNEQMDIYRNIGYRVLMVSSHTQDGLKPLEEALTGRISIFAGQSGVGKSSLLNALLGLQKEILTNDISDNSGLGQHTTTAARLYHFPHGGDVIDSPGVREFGLWHLEPEQITQGFVEFHDYLGLCKYRDCKHDTDPGCAIREAVEEGKIAETRFENYHRILESMAQVKTRKNFSDTDD

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

350 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

39.237 kDa

MSKNKLSKGQQRRVNANHQRRLKTSKEKPDYDDNLFGEPDEGIVISRFGMHADVESADGDVHRCNIRRTIRSLVTGDRVVWRPGKPAAEGVNVKGIVEAVHERTSVLTRPDFYDGVKPIAANIDQIVIVSAILPELSLNIIDRYLVACETLQIEPIIVLNKIDLLDDEGMEFVNEQMDIYRNIGYRVLMVSSHTQDGLKPLEEALTGRISIFAGQSGVGKSSLLNALLGLQKEILTNDVSDNSGLGQHTTTAARLYHFPHGGDVIDSPGVREFGLWHLEPEQITQGFVEFHDYLGLCKYRDCKHDTDPGCAIREAVEEGKIAETRFENYHRILESMAQVKTRKNFSDTDD

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

350 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

39.179 kDa

MSKNKLSKGQQRRVNANHQRRLKTSKEKPDYDDNLFGEPDEGIVISRFGMHADVESADGDVHRCNIRRTIRSLVTGDRVVWRPGKPAAEGVNVKGIVEAVHERTSVLTRPDFYDGVKPIAANIDQIVIVSAILPELSLNIIDRYLVACETLQIEPIIVLNKIDLLDDEGMAFVNEQMDIYRNIGYRVLMVSSHTQDGLKPLEEALTGRISIFAGQSGVGKSSLLNALLGLQKEILTNDVSDNSGLGQHTTTAARLYHFPHGGDVIDSPGVREFGLWHLEPEQITQGFVEFHDYLGLCKYRDCKHDTDPGCAIREAVEEGKIAETRFENYHRILESMAQVKTRKNFSDTDD

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

350 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

39.236 kDa

MSKNKLSKGQQRRVNANHQRRLKTSKEKPDYDDNLFGEPDEGIVISRFGMHADVESADGDVHRCNIRRTIRSLVTGDRVVWRPGKPAAEGVNVKGIVEAVHERTSVLTRPDFYDGVKPIAANIDQIVIVSAILPELSLNIIDRYLVACETLQIEPIIVLNKIDLLDDEGMKFVNEQMDIYRNIGYRVLMVSSHTQDGLKPLEEALTGRISIFAGQSGVGKSSLLNALLGLQKEILTNDVSDNSGLGQHTTTAARLYHFPHGGDVIDSPGVREFGLWHLEPEQITQGFVEFHDYLGLCKYRDCKHDTDPGCAIREAVEEGKIAETRFENYHRILESMAQVKTRKNFSDTDD

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

350 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

39.181 kDa

MSKNKLSKGQQRRVNANHQRRLKTSKEKPDYDDNLFGEPDEGIVISRFGMHADVESADGDVHRCNIRRTIRSLVTGDRVVWRPGKLAAEGVNVKGIVEAVHERTSVLTRPDFYDGVKPIAANIDQIVIVSAILPELSLNIIDRYLVACETLQIEPIIVLNKIDLLDDEGMAFVNEQMDIYRNIGYRVLMVSSHTQDGLKPLEEALTGRISIFAGQSGVGKSSLLNALLGLQKEILTNDVSDNSGLGQHTTTAARLYHFPHGGDVIDSPGVREFGLWHLEPEQITQGFVEFHDYLGLCKYRDCKHDTDPGCAIREAVDEGKIAETRFENYHRILESMAQVKTRKNFSDTDD

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

350 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

39.499 kDa

MSKRKLTQNQQRRIQSNNAKTLHRHQHRHKSDIDWQDDMLGDFQDGTVVTRYAVHADVENEQGEIVRCNLRRTLKSVVVGDRVVWRKGKEQLQGVRGVIEAVQPRHNQIVRPDYYDGLKSIAANIDRIIIVSAVLPNLSLNIIDRYLVVCESSNIPAVIVVNKADLLSSEARTEVSLQLEIYQKIGYETLLISAKSGENMDKLTALLSEGTSIFVGQSGVGKSSLINYILPEVNAQTGKLSQVSGLGQHTTTSSRLYHLSQGGNLIDSPGIREFGLWHLDREQITNGYREFQYFLGTCKFRDCKHLHDPGCAIQLAVKEGKIDPLRFENYHRLITSLSETKSQRHFISAN

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

350 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

39.547 kDa

MSKRKLTQNQQRRIQSNNAKTLHRHQHRHKSDIDWQDDMLGDFQDGTVVTRYAVHADVENEQGEIIRCNLRRTLKSVVVGDRVVWRKGKEQLQGVRGVIEAVQPRHNQIVRPDYYDGLKPIAANIDRIIIVSAVLPNLSLNIIDRYLVVCESSNIPAVIVVNKADLLSSEARIEVGLQLEIYRKIGYETLLISAKSGENMEKLTALLSEGTSIFVGQSGVGKSSLINYILPEVNAQTGKLSQVSGLGQHTTTSSRLYHLSQGGNLIDSPGIREFGLWHLDREQITNGYREFQYFLGTCKFRDCKHLHDPGCAIQLAVKEGKIDPLRFENYHRLITSLSETKSQRHFISAN

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

350 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

39.179 kDa

MSKNKLSKGQQRRVNANHQRRLKTSKEKPDYDDNLFGEPDEGIVISRFGMHADVESADGDVHRCNIRRTIRSLVTGDRVVWRPGKPAAEGVNVKGIVEAVHERTSVLTRPDFYDGVKPIAANIDQIVIVSAILPELSLNIIDRYLVACETLQIEPIIVLNKIDLLDDEGMAFVNEQMDIYRNIGYRVLMVSSHTQDGLKPLEEALTGRISIFAGQSGVGKSSLLNALLGLQKEILTNDVSDNSGLGQHTTTAARLYHFPHGGDVIDSPGVREFGLWHLEPEQITQGFVEFHDYLGLCKYRDCKHDTDPGCAIREAVEEGKIAETRFENYHRILESMAQVKTRKNFSDTDD

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

350 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

39.121 kDa

MSKNKLSKGQQRRVNANHQRRLKTSKEKPDYDDNLFGEPDEGIVISRFGMHADVESADGDVHRCNIRRTIRSLVTGDRVVWRPGKPAAEGVNVKGIVEAVHERTSVLTRPDFYDGVKPIAANIDQIVIVSAILPELSLNIIDRYLVACETLQIEPIIVLNKIDLLDDEGMAFVNEQMDIYRNIGYRVLMVSSHTQDGLKPLAEALTGRISIFAGQSGVGKSSLLNALLGLQKEILTNDVSDNSGLGQHTTTAARLYHFPHGGDVIDSPGVREFGLWHLEPEQITQGFVEFHDYLGLCKYRDCKHDTDPGCAIREAVEEGKIAETRFENYHRILESMAQVKTRKNFSDTDD

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

350 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

39.092 kDa

MSKNKLSKGQQRRVQANHQRRLRTDRKPELDDSQLGDAQEGIVISRFGQHADVEAVDGTQHRCNIRRTIKSLVTGDRVVWRPGLQAQEGVRVKGIVEAVHERTSVLTRPDLYDGVKPIAANIDQIVIVSAILPELSLNIIDRYLVACETLEVEPLIVLNKIDLLDADGRKFVDGMMDIYRRIGYDVLEVSSQTREGMEAFENALTGRISIFAGQSGVGKSSLLNALLPPTDNEILVNTVSGNSGLGQHTTTAARLYHFQHGGDVIDSPGVREFGLWHLAPEQITQGFVEFRDYLGHCKFRDCSHTNDPGCALREAVEQGKIAEERFDNYHRILESMEQAKPRKTSDSDEK

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

350 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

39.179 kDa

MSKNKLSKGQQRRVNANHQRRLKTSKEKPDYDDNLFGEPDEGIVISRFGMHADVESADGDVHRCNIRRTIRSLVTGDRVVWRPGKPAAEGVNVKGIVEAVHERTSVLTRPDFYDGVKPIAANIDQIVIVSAILPELSLNIIDRYLVACETLQIEPIIVLNKIDLLDDEGMAFVNEQMDIYRNIGYRVLMVSSHTQDGLKPLEEALTGRISIFAGQSGVGKSSLLNALLGLQKEILTNDVSDNSGLGQHTTTAARLYHFPHGGDVIDSPGVREFGLWHLEPEQITQGFVEFHDYLGLCKYRDCKHDTDPGCAIREAVEEGKIAETRFENYHRILESMAQVKTRKNFSDTDD

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

350 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

39.237 kDa

MSKNKLSKGQQRRVNANHQRRLKTSKEKPDYDDNLFGEPDEGIVISRFGMHADVESADGDVHRCNIRRTIRSLVTGDRVVWRPGKPAAEGVNVKGIVEAVHERTSVLTRPDFYDGVKPIAANIDQIVIVSAILPELSLNIIDRYLVACETLQIEPIIVLNKIDLLDDEGMEFVNEQMDIYRNIGYRVLMVSSHTQDGLKPLEEALTGRISIFAGQSGVGKSSLLNALLGLQKEILTNDVSDNSGLGQHTTTAARLYHFPHGGDVIDSPGVREFGLWHLEPEQITQGFVEFHDYLGLCKYRDCKHDTDPGCAIREAVEEGKIAETRFENYHRILESMAQVKTRKNFSDTDD

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

350 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

39.237 kDa

MSKNKLSKGQQRRVNANHQRRLKTSKEKPDYDDNLFGEPDEGIVISRFGMHADVESADGDVHRCNIRRTIRSLVTGDRVVWRPGKPAAEGVNVKGIVEAVHERTSVLTRPDFYDGVKPIAANIDQIVIVSAILPELSLNIIDRYLVACETLQIEPIIVLNKIDLLDDEGMEFVNEQMDIYRNIGYRVLMVSSHTQDGLKPLEEALTGRISIFAGQSGVGKSSLLNALLGLQKEILTNDVSDNSGLGQHTTTAARLYHFPHGGDVIDSPGVREFGLWHLEPEQITQGFVEFHDYLGLCKYRDCKHDTDPGCAIREAVEEGKIAETRFENYHRILESMAQVKTRKNFSDTDD

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

350 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

39.179 kDa

MSKNKLSKGQQRRVNANHQRRLKTSKEKPDYDDNLFGEPDEGIVISRFGMHADVESADGDVHRCNIRRTIRSLVTGDRVVWRPGKPAAEGVNVKGIVEAVHERTSVLTRPDFYDGVKPIAANIDQIVIVSAILPELSLNIIDRYLVACETLQIEPIIVLNKIDLLDDEGMAFVNEQMDIYRNIGYRVLMVSSHTQDGLKPLEEALTGRISIFAGQSGVGKSSLLNALLGLQKEILTNDVSDNSGLGQHTTTAARLYHFPHGGDVIDSPGVREFGLWHLEPEQITQGFVEFHDYLGLCKYRDCKHDTDPGCAIREAVEEGKIAETRFENYHRILESMAQVKTRKNFSDTDD

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

350 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

39.179 kDa

MSKNKLSKGQQRRVNANHQRRLKTSKEKPDYDDNLFGEPDEGIVISRFGMHADVESADGDVHRCNIRRTIRSLVTGDRVVWRPGKPAAEGVNVKGIVEAVHERTSVLTRPDFYDGVKPIAANIDQIVIVSAILPELSLNIIDRYLVACETLQIEPIIVLNKIDLLDDEGMAFVNEQMDIYRNIGYRVLMVSSHTQDGLKPLEEALTGRISIFAGQSGVGKSSLLNALLGLQKEILTNDVSDNSGLGQHTTTAARLYHFPHGGDVIDSPGVREFGLWHLEPEQITQGFVEFHDYLGLCKYRDCKHDTDPGCAIREAVEEGKIAETRFENYHRILESMAQVKTRKNFSDTDD

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

350 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

39.179 kDa

MSKNKLSKGQQRRVNANHQRRLKTSKEKPDYDDNLFGEPDEGIVISRFGMHADVESADGDVHRCNIRRTIRSLVTGDRVVWRPGKPAAEGVNVKGIVEAVHERTSVLTRPDFYDGVKPIAANIDQIVIVSAILPELSLNIIDRYLVACETLQIEPIIVLNKIDLLDDEGMAFVNEQMDIYRNIGYRVLMVSSHTQDGLKPLEEALTGRISIFAGQSGVGKSSLLNALLGLQKEILTNDVSDNSGLGQHTTTAARLYHFPHGGDVIDSPGVREFGLWHLEPEQITQGFVEFHDYLGLCKYRDCKHDTDPGCAIREAVEEGKIAETRFENYHRILESMAQVKTRKNFSDTDD

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

350 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

39.237 kDa

MSKNKLSKGQQRRVNANHQRRLKTSKEKPDYDDNLFGEPDEGIVISRFGMHADVESADGDVHRCNIRRTIRSLVTGDRVVWRPGKPAAEGVNVKGIVEAVHERTSVLTRPDFYDGVKPIAANIDQIVIVSAILPELSLNIIDRYLVACETLQIEPIIVLNKIDLLDDEGMEFVNEQMDIYRNIGYRVLMVSSHTQDGLKPLEEALTGRISIFAGQSGVGKSSLLNALLGLQKEILTNDVSDNSGLGQHTTTAARLYHFPHGGDVIDSPGVREFGLWHLEPEQITQGFVEFHDYLGLCKYRDCKHDTDPGCAIREAVEEGKIAETRFENYHRILESMAQVKTRKNFSDTDD

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

350 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

39.237 kDa

MSKNKLSKGQQRRVNANHQRRLKTSKEKPDYDDNLFGEPDEGIVISRFGMHADVESADGDVHRCNIRRTIRSLVTGDRVVWRPGKPAAEGVNVKGIVEAVHERTSVLTRPDFYDGVKPIAANIDQIVIVSAILPELSLNIIDRYLVACETLQIEPIIVLNKIDLLDDEGMEFVNEQMDIYRNIGYRVLMVSSHTQDGLKPLEEALTGRISIFAGQSGVGKSSLLNALLGLQKEILTNDVSDNSGLGQHTTTAARLYHFPHGGDVIDSPGVREFGLWHLEPEQITQGFVEFHDYLGLCKYRDCKHDTDPGCAIREAVEEGKIAETRFENYHRILESMAQVKTRKNFSDTDD

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

350 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

39.151 kDa

MSKNKLSKGQQRRVNANHQRRLKTSKEKPDYDDNLFGEPDEGIVISRFGMHADVESADGDVHRCNIRRTIRSLVTGDRVVWRPGKPAAEGVNVKGIVEAVHERTSVLTRPDFYDGVKPIAANIDQIVIVSAILPELSLNIIDRYLVACETLQIEPIIVLNKIDLLDDEGMAFVNEQMDIYRNIGYRVLMVSSHTQDGLKPLEEALTGRISIFAGQSGVGKSSLLNALLGLQKEILTNDVSDNSGLGQHTTTAARLYHFPHGGDVIDSPGVREFGLWHLEPEQITQGFVEFHDYLGLCKYRDCKHDTDPGCAIQEAVEEGKIAETRFENYHRILESMAQVKTRKNFSDTDD

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

349 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

39.164 kDa

MSKKKLSKGQQRRVSANHQRRLKKTESKVEWEDSQLGDAQEGIIISRFGMHADVEATDGVVRRCNIRRTISSLVTGDRVVWRPGHESLAGISGIVEAVHPRHSVLTRPDYYDGIKPIAANIDQIVIVSAILPELSLNIIDRYLVACETLEVEPLIVLNKIDLLDEKSRQLVDKSMDIYRALKYRVLMVSSHTQQGIPELEQALTDRISIFAGQSGVGKSSLLNALLALGEKRILVNEVSDNSGLGQHTTTASRLYHFPHGGDVIDSPGVREFGLWHLEPEQVTSGFIELREYIGSCKFRDCKHENDPGCAINAARERGDIARERFDNYHRILESMTQVKMRKGFSDTDN

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

349 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

39.174 kDa

MSKKKLSKGQQRRVSANHQRRLKKTESKVEWEDSQLGDAQEGIIISRFGMHADVEATDGVVHRCNIRRTLSSLVTGDRVVWRPGHESLAGISGIVEAVHPRHSVLTRPDYYDGIKPIAANIDQIVIVSAILPELSLNIIDRYLVACETLEIEPLIVLNKIDLLDDESRQFVDKLMDIYRALNYRVLMVSSHTQQGIPELEQALTDRISIFAGQSGVGKSSLLNALLALDEERILVNEVSDNSGLGQHTTTASRLYHFPHGGDVIDSPGVREFGLWHLEPEQVTRGFIELRQYIGSCKFRDCKHENDPGCAINAALDRGEIAVERYDNYHRILESMAQVKTRKGFSDTDN

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

349 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

38.864 kDa

MSKNKLSKGQERRVQANHQRRLKRTDNKPELDDSQLGEPQDGIVISRFGMHADVEAADGTQHRCNIRRTLRSLVTGDRVVWRPGVGTHAGVKGIVEAVHERTSVLNRPDIYDGVKPIAANIDQIVIVSAILPELSLNMIDRYLVACETLEVEPLIVLNKIDLLDAEARKTVDGMMDIYRHIGYRVLEVSSQTREGMEAFEQALADRISIFAGQSGVGKSSLLNALLPPSDKQILVNQVSDVSGLGQHTTTAARLYHFQHGGDVIDSPGVREFGLWHLEPEQVTQAYVEFRDYLGGCKFRDCRHDTDPGCAIRGAMEKGDIAKERFENYHRILESMASVKVRKNFTDAAG

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

349 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

38.943 kDa

MSKKKLSKGQQRRVSANHQRRLKHADSKVEWDDSQLSEPQEGVIISRFGMHADVEAPDGKLHRCNIRRTIHSLVTGDRVVWRAGNETLAGISGIVEAVHPRQSVLTRPDYYDGLKPIAANIDQIVIVSAILPELSLNIIDRYLVACETLEIEPLIVLNKIDLLDDEGRAFVEEVMDIYRALHYRVLMMSSHTQQGVAELEAALTGRVSIFAGQSGVGKSSLLNALLYPDDAQILVNDVSDASGLGQHTTTAARLYHFPHGGDVIDSPGVREFGLWHLEPEQVTRGFIEFRDYLGSCKFRDCKHDTDPGCAIRAALERGEIAPERFDNYHRILESMAQVKTRKSFSAPDN

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

348 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

39.143 kDa

MAKRKLSKQQKWRIQKIQDERTKRATRKETQLESQLSGGELSAEQEGLIIAHYGQQLAVEALEPPHAGQIFRCYVRANIDSLVTGDLVIWRAGPDNSGVIVARQPRESALKRPDKFGQLKPIAANIDQILIVIAAEPEPHHNLVDRYLVASEAVGIPPLIILNKQDLINDANRDALQQFKDQYQQLGYEWIDASTNTQSGLDDLKQHLAHKTSIFVGQSGVGKSSLIKMLLPEEDVKVGDLSENVRKGTHTTTTAKLFHLPSGGDLIDSPGIREFGLWHIDEHTLEDGFVEFRPHLGHCRFRNCRHIQEPGCALQSAQESGEILTSRMESFLRIRESLQEQDIHEENL

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

348 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

39.325 kDa

MAKQKLTQNQKRRIHSNNAKALDRHRRQTKKQIDWQEDMLGETQDGVVVTRYSMHADVENAQGEVFRCNLRRTLAGVVVGDLVIWRQGHEKLQGISGVIEAVKPRKNELSRPDYYDGLKVMASNIDRIIIVSAVLPALSLNIIDRYLVICETANIPPVIVLNKIDLLSAEARQEAEQQLKIYRDIGYRTLMISAETGENMEKLTALLSQGTSIFVGQSGVGKSSLVNQIMPEVNAQTAEISENSGLGQHTTTSSRLYHLPQGGDLIDSPGIREFGLWHLDADQITKGYREFRHFLGACKFRDCKHLNDPQCALREAVEQGKIHPVRFDNYHRLISSKDEAKSQRHFTM

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

348 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

39.802 kDa

MSHLVGLVRAVQANYYRVRLREPSNGVEELLCVRRARLKKMGQQVCVGDWVVVSHPDWPGQRGAIAEILPRRNQLSRPAIANVDQILLLFALADPPADVHPITRFLLTAEGLNVEIQVVFTKADLVSPQEQQQWRDRLQQWGYRCHVLSLTQGIAWQALRPHLANKITVVCGPSGVGKSSLIRHLTPREDIRVGAVSDHWHRGRHTTRHVELFPLAEGGWIADTPGFNQPELPPDPRQLAAAFPEIRQRLSQDQCLFDNCRHDQEPGCCVRGNWERYPLYIEYLHQLETIASAEPSLAKVPLVKAKSDRQGQQRLEPLLDAKKYRRRSRRQQHQHVNPMAEEVLDSEW

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

346 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

36.745 kDa

MPLVEAVTASSPSLADLGWSEFFGDQLEASDANLIPTRIAMVHRDRLSGLSQTGQTDLSLAPQATTGDYAVGDWVLVEPHSHLVQRRLTRKTVLERRVQGGRGPQLAAANVDTLFIVTSCNADFNIARLERYLALANEAGTTPVILLTKADTAEDAEAYRKQAAALQRELAVVTLNPRIPGAASALAAWCGAGQTVALIGSSGVGKSTLVNTLAGSAQQSPQQTGAIREHDAKGRHTTTARSLHAIAGGGWVIDTPGMRTLQVSDVGYGIDTLFAEITELAPLCKFRDCTHVHEPGCAVQAALKAGTLDPERLARWRKLSDENQHNTPVQSGPRGAKSPAGRGKRR

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

346 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

38.845 kDa

MAKRKLTQNQTRRIQSNNAKTLHRHKKKDIEWSDEMLGESQEGVVVTRYSIHADVENEQGEIYRCNLRRTLSSLVVGDKVVWRKGNEQLQGVSGVIEAIHPRENEISRPDYYDGLKPIAANIDRIIIVSAVLPTLSLNIIDRYLVVCEIAGITPLIVLNKVDLLAQEQRQEIEDQLKIYQDIGYEILMISAKSGENMEKLTALLAQGTAIFVGQSGVGKSSLINHILPSVNAQVGDVSETSGLGQHTTTSSRLYHLPQGGNLIDSPGIREFGLWHLDAEQITKGYREFQYVLGTCKFRDCKHLSDPGCALREAVEQGKISPVRYDSYHRLIESLSETKSQRHFSLV

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

346 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

38.872 kDa

MAKRKLTQNQTRRIQSNNAKTLHRHKKKDIEWSDEMLGESQEGVVVTRYSIHADVENEQGEIYRCNLRRTLSSLVVGDKVVWRKGNEQLQGVSGVIEAIHPRENEISRPDYYDGLKPIAANIDRIIIVSAVLPTLSLNIIDRYLVVCEIAGITPLIVLNKVDLLAQEQRQEIEDQLKIYQDIGYEILMISAKSGENMEKLTALLAQGTAIFVGQSGVGKSSLINHILPSVNAQVGDVSETSGLGQHTTTSSRLYHLPQGGNLIDSPGIREFGLWHLDAEQITKGYREFQYVLGTCKFRDCKHLSDPGCALREAVEQGKISPVRYDNYHRLIESLSETKSQRHFSLV

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

346 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

38.971 kDa

MAKRKLTQNQTRRIQSNNAKTLHRHKKKDIEWSDEMLGESQEGVVVTRYSIHADVENEQGEIYRCNLRRTLSSLVVGDKVVWRKGNEQLQGVSGVIEAIHPRENEISRPDYYDGLKPIAANIDRIIIVSAVLPTLSLNIIDRYLVVCEIAEIKPLIVLNKVDLLAQEQRQEIEDQLKIYQDIGYEILMISAKSGENMEKLTALLAQGTAIFVGQSGVGKSSLINHILPSVNAQVGDVSETSGLGQHTTTSSRLYHLPQGGNLIDSPGIREFGLWHLDAEQITKGYREFQYVLGTCKFRDCKHLSDPGCALREAVEQGKISPVRYDNYHRLIESLSETKSQRHFSLV

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

346 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

38.886 kDa

MAKRKLTQNQTRRIQSNNAKTLHRHKKKEIEWSDEMLGESQEGVVVTRYSIHADVENEQGEIYRCNLRRTLSSLVVGDKVVWRKGNEQLQGVSGVIEAIHPRENEISRPDYYDGLKPIAANIDRIIIVSAVLPTLSLNIIDRYLVVCEIAGITPLIVLNKVDLLAQEQRQEIEDQLKIYQDIGYEILMISAKSGENMEKLTALLAQGTAIFVGQSGVGKSSLINHILPSVNAQVGDVSETSGLGQHTTTSSRLYHLPQGGNLIDSPGIREFGLWHLDAEQITKGYREFQYVLGTCKFRDCKHLSDPGCALREAVEQGKISPVRYDNYHRLIESLSETKSQRHFSLV

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

345 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

38.472 kDa

MSKNKLSKGQERRVQANHQRRLQQRERGAAHWDDQPLGEAQEGVVVSRFGMHADVEDAAGRIYRCNLRRTLKSLVTGDKVVWRAGSEQPSGVSGIVEAVHPRRSVLTRPDVYDGVKPIAANMDQIVIVSALLPELSLNIIDRYLVACETVEVEPLIVLNKIDLLTPASRTEVEQLMAIYRRIGYRVLMVSSQTGEGMDPFREALTGRTSIFTGQSGVGKSSLLNALLPPEHEKILVNNVSDNSGLGQHTTTTARLYHFSHGGHLIDSPGVRELGLWHLAPERIARGFIEFREYLGTCKFRDCRHDTDPGCAIRGAVESGTIAHERFDNYHRIFDSMAQVNARKSF

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

344 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

39.023 kDa

MSKRRLTQNQQRRIKSNHHKKIAKPELEWQDEMLGEVQQGIVVTRHAKHADVETEQGEIYRCNLRRTLKNVVVGDQVSWRKGNEQLQGISGVIEAIYPRKNELSRPDYYDGIKVMAANIDQIIIVSAVLPTLSLNIIDRYLVICETAKIPALIVLNKIDLLSESERQEVQKQLAIYENIGYETLCLSADTGENMEKLDRYLSRGTSIFVGQSGVGKSSLINQLLPEVNALTGAVSDISGLGQHTTTSSRLYHLPQGGNLIDSPGIREFGLWHLEPEQITLGYREFQSVLGTCKFRDCKHKSDPGCAVREAVEKGEINAIRFENYHRLIESRDETKSQRHFRTEE

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

344 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

39.023 kDa

MSKRRLTQNQQRRIKSNHHKKIAKPELEWQDEMLGEVQQGIVVTRHAKHADVETEQGEIYRCNLRRTLKNVVVGDQVSWRKGNEQLQGISGVIEAIYPRKNELSRPDYYDGIKVMAANIDQIIIVSAVLPTLSLNIIDRYLVICETAKIPALIVLNKIDLLSESERQEVQKQLAIYENIGYETLCLSADTGENMEKLDRYLSRGTSIFVGQSGVGKSSLINQLLPEVNALTGAVSDISGLGQHTTTSSRLYHLPQGGNLIDSPGIREFGLWHLEPEQITLGYREFQSVLGTCKFRDCKHKSDPGCAVREAVEKGEINAIRFENYHRLIESRDETKSQRHFRTEE

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

344 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

39.023 kDa

MSKRRLTQNQQRRIKSNHHKKIAKPELEWQDEMLGEVQQGIVVTRHAKHADVETEQGEIYRCNLRRTLKNVVVGDQVSWRKGNEQLQGISGVIEAIYPRKNELSRPDYYDGIKVMAANIDQIIIVSAVLPTLSLNIIDRYLVICETAKIPALIVLNKIDLLSESERQEVQKQLAIYENIGYETLCLSADTGENMEKLDRYLSRGTSIFVGQSGVGKSSLINQLLPEVNALTGAVSDISGLGQHTTTSSRLYHLPQGGNLIDSPGIREFGLWHLEPEQITLGYREFQSVLGTCKFRDCKHKSDPGCAVREAVEKGEINAIRFENYHRLIESRDETKSQRHFRTEE

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

343 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

37.402 kDa

MAKRQLNRRQNWRIEKIQGERAARAAKRESATLETLEGGDLGPEQTGLVIAHFGVQVEVEAQEGEASGQVFRCHLRANLPALVTGDRVVWRAGNQGIGVIVAQLPRTTELRRPDSRGQLKPVAANVDLIVIVFAPMPEPHANLIDRYLVAAEHAGIRPLLLLNKADLIDEQNAPALNALLAVYRTLGYPVLEVSAHHGDGMQTLQSQLDGHISVFVGQSGVGKSSLVNSLLPETDTRVGPLSEVSGQGTHTTTTARLFHFPRGGDLIDSPGIREFGLGHVSRADVEAGFIEFNDLIGTCRFRDCKHDREPGCALLKGLEDGRVQQQRMNSYRSIIASLPQDSY

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

343 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

37.717 kDa

MAKRQLNRRQNWRIEKIQGERAARAAKREQHVLQELEGGDLGPEQLGLVIAHFGVQVEVEAQDGEAAGQVFRCHLRANLPALVTGDRVVWRAGNQGIGVIVAQMPRSTELCRPNNHGQLKPVAANVDLIVIVFAPAPEPHPNLIDRYLVAAEHAGIRPLLLLNKADLINEENAPTLNAMLEVYRNLGYPLLEVSAHQGDGMQRLQQMLDGHISVFVGQSGVGKSSLVNSLLPDAGTRVGDLSEWSGQGTHTTTTARLYHFPNGGDLIDSPGIREFGLGHVSRDDVEDGFIEFRELIGNCRFRDCKHDREPGCALLKALEDGQVSQQRMSSYRSIIASLPEDSY

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

343 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

37.382 kDa

MAKRQLNRRQNWRIEKIQGERAARAAKRESSAVEALEGGDLGPEQTGLVIAHFGVQVEVEAREGETAGQVFRCYLRANLPALVTGDQVVWRAGNQGIGVIVAQLPRSTELCRPDSRGQLKPVAANVDMIVIVFAPMPEPHANLIDRYLVAAEHAGIRPLLLLNKADLIDEQNAPALNALLAVYRQLGYPLLEVSAHHGDGMEQLQALLDGRISVFVGQSGVGKSSLVNSLLPEVETRVGPLSEFSGQGTHTTTTARLFHFPGGGELIDSPGIREFGLGHVSRADVEAGFIEFNDLLGTCRFRDCKHDREPGCALLKALEDGRIQQQRMNSYRSILASLPDNSY

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

343 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

37.319 kDa

MAKRQLNRRQNWRIEKIQGERAARAAKRESSAVEALEGGDLGPEQTGLVIAHFGVQVEVEALEGELAGSVSRCHLRANLPALVTGDKVVWRAGNQGIGVIVAQLPRTTELRRPDSRGQLKPVAANVDMIVIVFAPLPEPHANLIDRYLVAAEHAGIRPLLLLNKFDLIDEQNAPALNALLAVYRTLGYPVLEVSAHHGNGMEQLQQQLDGRISVFVGQSGVGKSSLVNSLLPEVDTRVGPLSELSGQGTHTTTTARLFHFPGGGELIDSPGIREFGLGHVSRSDVEAGFIEFNDLIGTCRFRDCKHDREPGCALLKALEDGRVQQQRMNSYRSIIASLPESSY

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

343 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

37.571 kDa

MAKRQLNRRQNWRIEKIQGERAARAAKRESRAVEALEGGDLGPEQTGLVIAHFGVQVEIEGLQGELAGQVFRCHLRANLPALVTGDQVVWRPGNQGDGVIVAQLPRSSELCRPDMRGQLKPVAANVDQIVIVFAPLPEPHANLIDRYLVAAEHAGIRPLLLLNKADLIDEQNQVALEALLKVYRQLGYPLLEVSAHQGDGMEQLKKRLDGHVSVFVGQSGVGKSSLVNGLLPGVDTRVGALSELTGKGTHTTTTARLFHFPGGGQLIDSPGIREFGLGHVSRDDVEAGFIEFHDLLGRCRFRDCKHDREPGCALLQALEDGRIQAQRMASYRHILASLPEDDY

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

343 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

37.747 kDa

MAKRQLNRRQNWRIEKIQGERAARAAKREQHALQELEGGDLGPEQLGLVIAHFGVQVEVEAQDGETAGQVFRCHLRANLPALVTGDRVVWRAGNQGIGVIVAQMPRSTELCRPNNHGQLKPVAANVDLIVIVFAPAPEPHPNLIDRYLVAAEHAGLRPLLLLNKADLINDENGPGLHALLEVYRELGYPLLEVSAHHGDGMQRLQQQLDGHISVFVGQSGVGKSSLVNSLLPDAGTRVGDLSEWSGQGTHTTTTARLYHFPNGGDLIDSPGIREFGLGHVSRDDVEDGFIEFRDLFGTCRFRDCKHDREPGCALLKALEEGRIKPQRMNSYRSIIASLAEDSY

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

343 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

37.371 kDa

MAKRQLNRRQNWRIEKIQGERAARAAKRESSAVEALEGGDLGPEQHGLVIAHFGVQVEVEAVDGELAGQVFRCHLRANLPALVTGDQVVWRAGNQGIGVIVAQLPRTTELCRPDSRGQLKPVAANVDMIVIVFAPLPEPHANLIDRYLVAAEHAGIRPLLLLNKFDLIDEQNAPALNALLAVYRTLGYPVLEVSAHHGNGMEQLQKQLDGRISVFVGQSGVGKSSLVNSLLPEVETRVGPLSELSGQGTHTTTTARLFHFPGGGELIDSPGIREFGLGHVSRADVEAGFIEFNDLLGTCRFRDCKHDREPGCALLKALEDGRVQQQRMNSYRSIIASLPENGY

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

343 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

37.71 kDa

MAKRQLNRRQNWRIEKIQGERAARAAKREQHALQELEGGDLGPEQLGLVIAHFGVQVEVEAQDGEGAGQVFRCHLRANLPALVTGDRVVWRAGNQGIGVIVAQMPRSTELCRPNNHGQLKPVAANVDLIVIVFAPAPEPHPNLIDRYLVAAEHAGLRPLLLLNKADLINDENGPGLHALLEVYRELGYPLLEVSAHQGDGMQRLQQQLDGHISVFVGQSGVGKSSLVNSLLPDAGTRVGDLSEWSGQGTHTTTTARLYHFPNGGDLIDSPGIREFGLGHVSRDDVEDGFIEFRDLFGTCRFRDCKHDREPGCALLKALDEGRIKPQRMNSYRSIIASLTEDSY

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

343 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

37.747 kDa

MAKRQLNRRQNWRIEKIQGERAARAAKREQHALQELEGGDLGPEQLGLVIAHFGVQVEVEAQDGETAGQVFRCHLRANLPALVTGDRVVWRAGNQGIGVIVAQMPRSTELCRPNNHGQLKPVAANVDLIVIVFAPAPEPHPNLIDRYLVAAEHAGLRPLLLLNKADLINDENGPGLHALLEVYRELGYPLLEVSAHHGDGMQRLQQQLDGHISVFVGQSGVGKSSLVNSLLPDAGTRVGDLSEWSGQGTHTTTTARLYHFPNGGDLIDSPGIREFGLGHVSRDDVEDGFIEFRDLFGTCRFRDCKHDREPGCALLKALEEGRIKPQRMNSYRSIIASLAEDSY

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

343 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

37.911 kDa

MAKRQLNRRQNWRIEKIQNERAARAAKREQHALQELEGGDLGPEQLGLVIAHFGVQVEVEAQDGEFAGQVFRCHLRANLPALVTGDRVVWRAGNQGIGVIVAQMPRSTELCRPNNHGQLKPVAANVDLIVIVFAPAPEPHPNLIDRYLVAAEHAGIRPLLLLNKADLINDENGPALHALLEVYRDLGYPLLEVSAHHGDGMQRLQQMLDGHISVFVGQSGVGKSSLVNSLLPAADTRVGDLSEWSGQGTHTTTTARLYHFPNGGDLIDSPGIREFGLGHVSRDDVEDGFIEFRDLFGTCRFRDCKHDREPGCALLEALEDGRIKQQRMNSYRSIIASLPEDSY

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

343 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

37.444 kDa

MAKRQLNRRQNWRIEKIQGERAARAAKRESVTLETLEGGDLGPEQTGLVIAHFGVQVEVEAQEGEDVGKVFRCHLRANLPALVTGDRVVWRAGNQGIGVIVAQLPRTTELRRPDSRGQLKPVAANVDLIVIVFAPMPEPHANLIDRYLVAAEHAGIHPLLLLNKADLIDEQNAPALNALLAVYRTLGYPVLEVSAHQGDGMQSLQSQLDGHISVFVGQSGVGKSSLVNSLLPETDTRVGPLSEVSGQGTHTTTTARLFHFPRGGDLIDSPGIREFGLGHVSRADVEAGFIEFNDLIGTCRFRDCKHDREPGCALLKGLEDGRVQQQRMNSYRSIIASLPQDSY

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

343 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

37.43 kDa

MAKRQLNRRQNWRIEKIQGERAARAAKRESATLETLEGGDLGPEQTGLVIAHFGVQVEVEAQEGEVTGQVFRCHLRANLPALVTGDRVVWRAGNQGIGVIVAQLPRTTELRRPDSRGQLKPVAANVDLIVIVFAPMPEPHANLIDRYLVAAEHAGIRPLLLLNKADLIDEQNAPALNALLAVYRTLGYPVLEVSAHHGDGMQSLQSQLDGHISVFVGQSGVGKSSLVNSLLPETDTRVGPLSEVSGQGTHTTTTARLFHFPRGGDLIDSPGIREFGLGHVSRADVEAGFIEFNDLIGTCRFRDCKHDREPGCALLKGLEDGRVQQQRMNSYRSIIASLPQDSY

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

343 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

37.866 kDa

MAKRRLSKRQVDRIRERQSQRLDTSVAAPDGKQLGSEQAGLVIAHHGKQVQVETLDNSDDSPRRLRCHLRATLGSVVTGDRIVFQEDDSSGIIVAIQPRSSTLVRPDSYGKLKPVAANVDQLLITIACAPEPFSGLIDRYLAVAENLHIRPVLLFNKLDLLQSDEIDSAIANKVAKLRTLYTSLGYRCIDTCAKNGDGLDELRNTLQDNTSVFVGQSGVGKSSIIKKLLPDQEIAIGALSDAIDKGRHTTTHSELFHFPFGGDCIDSPGIREFGLWHLSPKEVTYGFIEIRDIAGLCKFRDCSHTHEPSCAVLNAVEDGSLHPERYENFQRIVQSLDDVNMQG

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

343 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

37.506 kDa

MAKRQLTRRQSWRIEKIQEERAARAAKRESRAVEELEGGDLGPEQNGLVIAHFGVQVEVEAEDGELAGQVCRCHLRANLPALVTGDRVVWRAGNQGGGVIVAQLPRRSELCRPDMRGQLKPVAANVDRIVIVFAPLPEPHANLIDRYLVAAEHAGIRPLLLLNKADLVNEENAAGLDALLATYQRLGYPLLEVSARQGAGMQELQAALDGHVSVFVGQSGVGKSSLVNSLLPGVDTRVGALSEQTGKGMHTTTTARLFHFPGGGELIDSPGIREFSLGHVRRADVEAGFIEFRDLLGHCRFRDCRHDREPGCALLKALDEGRIQPQRMASYRHILASLPEPEY

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

342 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

38.572 kDa

MSKHRLTQNQQRRINANHHKKITRSKFEWQDDMLGEIQAGTIVTRHAKHADVEAENGEIIRCNLRRTLKNVVVGDHVSWRKGSQQLQGISGVIEAVYPRHNELSRPDYYDGIKVMASNIDQIIIISAVMPVLSLNIIDRYLVICENAGIPALIVLNKIDLLSEQERQHVQQQLAIYENIGYQTLCLSANTGENMDKLDRYLANGTSIFVGQSGVGKSSLINQLLPEVHAITGAISDISGLGQHTTTASRLYHLPQGGNLIDSPGIREFGLWHLTPEQITLGYCEFQTILGNCKFRDCKHNTDPGCAIKHAVEKGLINPIRFENYHRLIESRDETKSQRHFRT

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

341 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

37.432 kDa

MIEPVVGYRMLQAIGWPWPGPPADAAWQAMCAVYSQCRPARVIEQHRSGYVVAEAPEVPIKVESLPAWQRRGFPRHERAVVGDWVLLDGRRIVALLPRRTVIKRLAAGEHYRQQLIAANLDTAFIVCGLDGDFNPRRIERYCVLIGSGGVEPVVVLTKVDLCADVGAAVAVLREHSSQALAVVAVDAREAEPVAALYPWLLPGRTVALLGSSGAGKSTLTNTLLGEQRMKVGEVRQRDSRGRHTTTHRALLPLPSGACLIDTPGMRELKFTGEEDLVEEFADIELLATQCRFRDCAHQAEPGCAVRAAIGCGTLDPQRLHHYFKLRGEIVGAADRSTLRRY

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

341 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

37.565 kDa

MIEPVVGYRMLQAIGWPWPGPPADSAWQAMCAMYSQCRPARVIEQHRSGYVVAEAPEVPIKVESLPAWQRRSFPPHERAVVGDWVLLDGRRIVALLPRRTVIKRLAAGEHYRQQLIAANLDTAFIVCGLDGDFNPRRIERYCVLIASGGVEPVVVLTKVDLCVDVAAAVAVLREHSSQALAVVAVDARKAEPVVALYPWLLPGRTVALLGSSGAGKSTLTNTLLGEQRMKVGEVRQRDSRGRHTTTHRALLPLPSGACLIDTPGMRELKFTGEEDLVEEFADIELLATQCRFRDCAHQAEPGCAVRAAIGCGTLDPQRLHHYFKLRGEIVGAADRSMLRRY

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

340 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

37.7 kDa

MSKRKLSRQQRWRVEKIQAERAERAERRARRDDTSLDAGDYGPERLGRVTAHFGRTLEVEAEDEHGDLQRHRCHLRANLEGLVTGDHVVWRVAADGSGVVVARQPRQSVLERPDARGQLKPVAANIAQILIVFAVEPAPHPNLIDRYLVAAEATGITPVLVLNKTDLLPETGSDLRTLLARYRAIGYRVVAASTQQEGGLDALHACLTERTSVFVGQSGVGKSSLIDRLLPDMQLRVGALSADSRKGTHTTTTATLYHLPAGGELIDSPGIREFGLGHLEEHQVAQGFIEFQPYLGHCRFRDCRHRQEPGCALRDAVERGDILASRFDSYRHIVDGLTTR

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

339 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

37.064 kDa

MAKRHLTRRQSWRIEKIQEERAARAARRESRAVDELEGGDLGPEQTGQVIAHFGVQVEVESADGQVSRCHLRANLPALVTGDQVVWRAGNQGIGVIVAQLPRRSELCRPDMRGLLKPVAANVDRIVIVFAPRPEPHANLIDRYLIAAEHAGIQPLLLLNKADLVDESNAEGIDALLNVYRTLGYPLIEVSAFNGLAMDELRGALDGHVSVFVGQSGVGKSSLVNALLPGVDTRVGDLSTVTGKGTHTTTTARLFHFPGGGDLIDSPGIREFGLGHVSRDDVEAGFIEFRDLLGHCRFRDCKHDREPGCALLQALEDGRIMPQRMASYRHILASMPETDY

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

339 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

37.09 kDa

MAKRHLTRRQSWRIEKIQEERAARAARRELRAVDELEGGDLGPEQTGQVIAHFGVQVEVESADGQVSRCHLRANLPALVTGDQVVWRAGNQGIGVIVAQLPRRSELCRPDMRGLLKPVAANVDRIVIVFAPRPEPHANLIDRYLIAAEHAGIQPLLLLNKADLVDESNAEGIDALLNVYRTLGYPLIEVSAFNGLAMDELRGALDGHVSVFVGQSGVGKSSLVNALLPGVDTRVGDLSTVTGKGTHTTTTARLFHFPGGGDLIDSPGIREFGLGHVSRDDVEAGFIEFRDLLGHCRFRDCKHDREPGCALLQALEDGRIMPQRMASYRHILASMPETDY

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

339 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

37.078 kDa

MAKRHLTRRQSWRIEKIQEERAARAARRESRAVEELEGGDLGPEQTGQVIAHFGVQVEVESADGQVSRCHLRANLPALVTGDQVVWRAGNQGIGVIVAQLPRRSELCRPDMRGLLKPVAANVDRIVIVFAPRPEPHANLIDRYLIAAEHAGIQPLLLLNKADLVDESNAEGIDALLNVYRTLGYPLIEVSAFNGLAMDELRGALDGHVSVFVGQSGVGKSSLVNALLPGVDTRVGDLSTVTGKGTHTTTTARLFHFPGGGDLIDSPGIREFGLGHVSRDDVEAGFIEFRDLLGHCRFRDCKHDREPGCALLQALEDGRIMPQRMASYRHILASMPETDY

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

332 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

36.519 kDa

MLQAIGWPWPGPPADSAWQAMCAMYSQCRPARVIEQHRSGYVVAEAPEVPIKVESLPAWQRRSFPPHERAVVGDWVLLDGRRIVALLPRRTVIKRLAAGEHYRQQLIAANLDTAFIVCGLDGDFNPRRIERYCVLIASGGVEPVVVLTKVDLCVDVAAAVAVLREHSSQALAVVAVDARKAEPVVALYPWLLPGRTVALLGSSGAGKSTLTNTLLGEQRMKVGEVRQRDSRGRHTTTHRALLPLPSGACLIDTPGMRELKFTGEEDLVEEFADIELLATQCRFRDCAHQAEPGCAVRAAIGCGTLDPQRLHHYFKLRGEIVGAADRSMLRRY

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

332 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

36.514 kDa

MLQAIGWPWPGPPADAAWQAMCAVYSQCRPARVIEQHRSGYVVAEAPEVPIKVESLPAWQRRGFPPHERAVVGDWVLLDGRRIVALLPRRTVIKRLAAGKHYRQQLIAANLDTAFIVCGLDGDFNPRRIERYCVLIASGGVEPVVVLTKVDLCVDVGAAVAVLREHFSQALAVVAVDARKAEPVVALYPWLLPGRTVALLGSSGAGKSTLTNTLLGEQRMKVGEVRQRDSRGRHTTTHRALLPLPSGACLIDTPGMRELKFTGEEDLVEEFADIELLATQCRFRDCAHQVEPGCAVRAAIGCGTLDPQRLHHYFKLRGEIVGAADRSMLRRY

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

326 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

37.259 kDa

MTGIVYKSTGSWYTVKSLQGHFMECRIKGKFRMKGIKSTNPIAVGDVVDYDLDENSDVVTGTITKIHDRKNYIVRKSVNLSHQMHIIASNLDYVFLLITINNPPTTTNFIDRFLVTAQAYGIETILVFNKIDTYNEAMLDEQLFMQYIYQEIGYKCLRVSSTEGKGIEELKNIMKNKVTMFSGHSGVGKSTLVNAMEPTLHLKTKTISEQSKQGQHTTTFAEMYDLSFGAQIIDTPGIKGFGIVDMEKEEISGYFPEFFKLKDQCKFNNCLHKDEPKCAVKDALEKDKISYSRYNSYLKILEGDDETYRTDIYNDDRIASDETRNK

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

325 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

36.807 kDa

MTGTVYKSTGSWYTVKSEKGDFVECRMKGKFRIKGIKSTNPIAVGDIVDYELDETSDAVTGTIHTIHERKNYIVRKSVNLSKQIHIIASNIDQVFLLVTIDNPPTTTSFIDRFLVTAEAYGIEAILIFNKIDTLNEQTLDDQLYLQHIYTEIGYKCLRISSTENKGVDKLKEMMVGKVSMFSGHSGVGKSTLVNAMEPSLHLKTSVISEQSKQGQHTTTFAEMYDLSFDARIIDTPGIKGFGIVDMEPTEISGYFPEFFKLKDQCKFNNCLHKEEPHCAIKAALEKDEIAWSRYNSYLKILEGDEEHYRTDIYGEDRAASDETRK

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

321 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

35.743 kDa

MAAAEAPRLAGMVVALQANFLEVELETFNPSSLVSWRRSTDAEPLRLLCTRRTRLDHRGAAVHVGDRVWVEAIDWQERRAVVGDVEPRQSWINRPPVANVTAVVVALAVKQPCFDADQASRFLLSAEQTGVDVHLILTKRDLITSDQLEQQLVRLRGWGYRPMAVSVQTGEGLGALKNKLSSTRLAVFCGPSGVGKTSLLNQLLPQLSLRVGAVSGRLQRGRHTTRHVELFRLCEGSLVADTPGFNRPELPADPRKLAVLFPEFDGQIEDYPCRFRDCFHRDEPGCGVDKSWERYPIYKRFLEEMECLSRSSRGGSGSGLL

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

321 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

35.629 kDa

MAAAEAPRLAGMVVALQANFLEVELETFNPSSLVSWTGSTDDEPLRLLCTRRTRLDHRGAAVHVGDRVWVEAIDWQERRAVVGDVEPRQSWINRPPVANVTAVVVALAVKQPCFDADQASRFLLSAEQTGVDVHLILTKRDLITSDQLEQQLVRLRGWGYRPMAVSVQTGEGLGALKNKLSSTRLAVFCGPSGVGKTSLLNQLLPQLSLRVGAVSGRLKRGRHTTRHVELFRLCEGSLVADTPGFNRPELPADLRKLAVLFPELDGQLEDYPCRFRDCFHRDEPGCGVDKSWERYPIYKRFLEEMECLTRSSRGGSGSGLL

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

318 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

34.854 kDa

MTRGKPGRAGHDRRHASTGEHGLVIAAHGRHYLVERKGGGLLQCFPRGKRSECAVGDRVIFEATAVDQGVVVRVEERRNLLHRSDQFKSKQLAANIDQVLIMLGTEPGFSEDLLGRALVAAESLGITPLILLNKIDLTARLETARARLALYRALGYAVVELSVHAAPEAAHAVLAAHVAGRSSILIGQSGMGKSSLLNLLIPGVDAQTREISEKLDSGKHTTTFTRLYHLPSGWGHGGTLIDSPGFQEFGLHHLTEGMLERAFPEFRPRLTECRFYNCRHLQEPGCGILGAMAEGKIDPRRHALYAQLLHESEQQKPW

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

318 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

34.587 kDa

MAKPGRTPAKGAGTSARILHDGLVIASHGRHCLVETPTGERLICHPRGKKSQAVVGDRVRWQASEDEGTIEEVVPRRNLFYRQDEIRTKSFAANLDHVLILIAAEPEFSEHQLARALIAAEAERITPIIALNKSDLAEPFERAWNKLAPYRRMHHGVLPLSLKASGEADYASLMKLLAGKSTLVLGPSGAGKSTLINLLVPGATALTGEISQALNSGKHTTTSTTWYWVDEARTTSLIDSPGFQEFGLNHIAPMQLAGLMPDIAEHANDCKFYNCTHLHEPGCGVIANVDAPGKPGPISATRYRIYGELFAELSQSRY

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

317 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

34.798 kDa

MSGRSPKALRAATANDRAQDRVRGLVIAAHGRHYIVAPEDGSAILQCFPRGKRSEIAVGDQVLYEPTSADQGVIVEIGERRNLLYRSDQYKSKLFAANLDQLLIVLATEPHFSEDLLGRALVAAEENELKPLIVLNKIDVEAALPLARKRLQLYRGLGYTVLEVSIKGQPDAARATLEAHLNGHSTLLLGQSGMGKSTLVNLLIPDAEVATREISTALNSGRHTTTFTRLYPLPGSEGALIDSPGFQEFGLHHLTEGKLERAFPEFRPLLAECRFYNCHHLHEPGCAILEAVADGRIAKERHALYAQLVHEASQIVR

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

316 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

34.566 kDa

MSGRSPKAPRAPSSTRVGGLVVAAHGRHYLVAPDDGGAMLQCFPRGKRSEVAVGDRVVYELASADQGVIVEIGERRNLLYRSDQYKSKLFAANLDQLLVVLATEPHFSEDLLGRALVAAEANELKPLIVLNKTDVTDALEGARKRLEPYRALGYTVVEVSIKMQPEAARAALIEHLQGHSTLLLGQSGMGKSTLVNLLIPDAEVATREISTALNSGRHTTTFTRLYPLPDSADGEGGALIDSPGFQEFGLHHLTEGRLERAFPEFRPLLPNCRFYNCHHLQEPGCAILEAVADGRIRRERHALYAQLVHEASQIVR

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

316 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

34.556 kDa

MSGRSPKAPRAPSSTRAGGLVVAAHGRHYLVAPDDGGAMLQCFPRGKRSEVAVGDHVIYELASADQGVIVEIGERRNLLYRSDQYKSKLFAANLDQLLIVLATEPHFSEDLLGRALVAAEANGLKPLIVLNKTDVTDELEGARKRLEPYRALGYTVVEVSIRTQPEAARAALIERLHGHSTLLLGQSGMGKSTLVNLLIPDAEVATREISTALNSGRHTTTFTRLYPLPDSADGTGGSLIDSPGFQEFGLHHLTEGRLERAFPEFRPLLPNCRFYNCHHLHEPGCAILEAVADGRIRRERHALYAQLVHEASQIVR

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

316 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

35.746 kDa

MSKLSHQQQRRIHNHRQNKLAAGDRADAALVVAHLGYQLIVDDHGEILAADWRQKLGAIAVNDRVLITRDQPQHAIVEGIYPREKTLYKQHAGKLKPVASNIDQLLITFAPVPDWQNALLDRFLVAAHQAHIEPAFFCNKSDLFDAQTFAAAENRLAIYHQLGYRVFYGSIYQKTGLEELTHWLSGRQTVICGQSGVGKSSFIHYLMPDIDVWTQAVSAARGFGQHTTRNARRYPLDAHTAIIDTPGVRGFSLTHLQHSEVVSGFPEIHQYTHECRFNDCSHQHEPDCGVQRALERGDISLERFNSMMQICAEREV

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

315 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

34.493 kDa

MDGVVIKNTGSQYLVRCTDGTELYCMAKGNLRLKGIRSTNPVAVGDRVEIVPASQDGQPAYIKRIHPRRNYIIRRASNLSKESHILGANLDAAVLVCTINDPVTTTVFIDRFLATAEAYRVPVILAFNKIDCYTQEDRLQLDRLSAVYTAIGYPCCHVSAITGEGLPDLKSLLDGKLTLLAGHSGVGKSSLINALIPHADLRTGAISQAHHTGMHTTTFSQMIDFPDLSPGSALIDTPGIKGFGTLEMGEYEVSHYFPEIFAASKGCRFGNCTHTHEPGCAVLEALRRGEIAESRYISYLSILEDENAERYRPEY

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

315 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

34.551 kDa

MDGVVIKNTGSQYLVRCTDGTELYCMAKGNLRLKGIRSTNPVTVGDRVEIVPASQDGQPAYIKRIHPRRNYIIRRASNLSKESHILGANLDAAVLVCTINDPVTTTVFIDRFLATAEAYRVPVILVFNKIDCYTQEDRLQLDRLSAVYTAIGYPCCHVSAITGEGLPDLKSLLDGKLTLLAGHSGVGKSSLINALIPHADLRTGAISQAHHTGMHTTTFSQMIDFPDLSPGSALIDTPGIKGFGTLEMGEYEVSHYFPEIFAASKGCRFGNCTHTHEPGCAVLEALRRGEIAESRYISYLSILEDENAERYRPEY

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

315 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

34.759 kDa

MTRGKPGRAHKQAATGEHGLVIAAHGRHYLVERDGGGFLQCFPRGKRSECAVGDRVVYEATAVDQGVVVRVDERRNLLYRSDQFKSKVLAANLDQVIIMLGTEPSFSEDLLGRALVAAESLGITPLILLNKIDLTARLETARSRLALYRDLGYTIVELTVHGAPEAAHAALEPHVAGRASILIGQSGMGKSSLLNLLIPGVDAQTREISEKLDSGKHTTTFTRLYHLPADWGQGGMLIDSPGFQEFGLHHLSEGMLERAFPEFRPRLTECRFYNCRHLQEPGCGILGAMAEGKIDPRRHQLYAQLLHESEQQKPW

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

315 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

35.806 kDa

MQGTVYKSTGSWYQVKAEDGKFYECRIKGKFRIQGIKSTNPVAVGDEVSFDLEEGVEEKTGVIKKIKERENYIIRKSVNLSKQTHIIASNIDQVFLLITLNNPPTLTTFIDRFLVTAEAYDITAVLLFNKVDTYSIEELAEVKYLAELYRSAGYECIGISAKNGKNVDKVKDKMIGNTSMISGHSGTGKSTLINAIEPALDLKTSEISRQHSQGQHTTTFAEMFDLSFNARIIDTPGIKGFGVVDMDREEIGDYFPEFFERKQDCKFHNCLHIEEPKCAIKDSLEEGEIAWSRYKSYLQIMEGEEDNYRVDQYQK

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

314 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

34.248 kDa

MKRAPTKQPAKPAARGGERAQGRVIAAHGRHYIVAPADGGPMLQCFPRGKKSEVAVGDRVAYERTSADQGVIVEIGERRNLLYRSDQFKSKLFAANLDQLLIVLATEPYFSEDLLGRALIAAEANELKPIVVLNKIDVEAALPVARERLAPYRALGYDVLELSVKGAPDDARAQLAPRLAGHSTILLGQSGMGKSTLVNLLVPDAEAATREISAALNSGRHTTTFTRLYPLQDGGALIDSPGFQEFGLYHLTEGRLERAFPEFRPLLAHCRFYNCHHLHEPGCAILEALADGRIAPTRHALYAQLVHEASQIVR

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

314 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

34.278 kDa

MKRAPTKQPAKPAARGGERAQGRVIAAHGRHYIVAPADGGPMLQCFPRGKKSEVAVGDRVAYERTSADQGVIVEIGERRNLLYRSDQFKSKLFAANLDQLLIVLATEPYFSEDLLGRALIAAEANELKPIVVLNKIDVEAALPVARERLAPYRALGYDVLELSVKGAPDDARTQLAPRLAGHSTILLGQSGMGKSTLVNLLVPDAEAATREISAALNSGRHTTTFTRLYPLQDGGALIDSPGFQEFGLYHLTEGRLERAFPEFRPLLAHCRFYNCHHLHEPGCAILEALADGRIAPTRHALYAQLVHEASQIVR

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

314 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

34.248 kDa

MKRAPTKQPAKPAARGGERAQGRVIAAHGRHYIVAPADGGPMLQCFPRGKKSEVAVGDRVAYERTSADQGVIVEIGERRNLLYRSDQFKSKLFAANLDQLLIVLATEPYFSEDLLGRALIAAEANELKPIVVLNKIDVEAALPVARERLAPYRALGYDVLELSVKGAPDDARAQLAPRLAGHSTILLGQSGMGKSTLVNLLVPDAEAATREISAALNSGRHTTTFTRLYPLQDGGALIDSPGFQEFGLYHLTEGRLERAFPEFRPLLAHCRFYNCHHLHEPGCAILEALADGRIAPTRHALYAQLVHEASQIVR

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

314 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

34.238 kDa

MKRAPTKQPAKPAARGGERAQGRVIAAHGRHYIVAPADGGSMLQCFPRGKKSEVAVGDRVAYERTSADQGVIVEIGERRNLLYRSDQFKSKLFAANLDQLLIVLATEPYFSEDLLGRALIAAEANELKPIVVLNKIDVEAALPVARERLAPYRALGYDVLELSVKGAPDDARAQLAPRLAGHSTILLGQSGMGKSTLVNLLVPDAEAATREISAALNSGRHTTTFTRLYPLQDGGALIDSPGFQEFGLYHLTEGRLERAFPEFRPLLAHCRFYNCHHLHEPGCAILEALADGRIAPTRHALYAQLVHEASQIVR

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

314 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

34.412 kDa

MSVGADRKKTGTSLTGKVVAAYGRHFEVEVAGGTIYSCVVRGKKKGVVCGDEVEILPATGDQGIIETTLPRTSLFYRSEIFREKLIAANATQLVFVLAVVPSCNLELLDRCLVAAESQGIRPLILLNKIDLIGQDEQRQAVAHHLMFYRELGYPVLEISAKISVQPLIPLLSGQTSLLAGQSGVGKSTLLNALVPRAQQATAEISDALDSGRHTTTHVRLFHFDADSSIIDSPGFQEFGLQQLDEASLARGFIEFRPFLGQCKFRDCRHIAEPGCKLLLAAQEGMLNSRRIACYHKLVKGLKKSHPWMETNKRV

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

314 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

34.406 kDa

MKRAPTKQPAKPAARGGERAQGRVIAAHGRHYIVAPADGGPMLQCFPRRKKSEVAVGDRVAYERTSADQGVIVEIGERRNLLYRSDQFKSKLFAANLDQLLIVLATEPYFSEDLLGRALIAAEANELKPIVVLNKIDVEAALPVARERLAPYRALGYDVLELSVKSAPDDARTQLAPRLAGHSTILLGQSGMGKSTLVNLLVPNAEAATREISAALNSGRHTTTFTRLYPLQDGGALIDSPGFQEFGLYHLTEGRLERAFPEFRPLLAHCRFYNCHHLHEPGCAILEALADGRIAPTRHALYAQLVHEASQIVR

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

314 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

34.406 kDa

MKRAPTKQPAKPAARGGERAQGRVIAAHGRHYIVAPADGGPMLQCFPRRKKSEVAVGDRVAYERTSADQGVIVEIGERRNLLYRSDQFKSKLFAANLDQLLIVLATEPYFSEDLLGRALIAAEANELKPIVVLNKIDVEAALPVARERLAPYRALGYDVLELSVKSAPDDARTQLAPRLAGHSTILLGQSGMGKSTLVNLLVPNAEAATREISAALNSGRHTTTFTRLYPLQDGGALIDSPGFQEFGLYHLTEGRLERAFPEFRPLLAHCRFYNCHHLHEPGCAILEALADGRIAPTRHALYAQLVHEASQIVR

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

314 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

34.406 kDa

MKRAPTKQPAKPAARGGERAQGRVIAAHGRHYIVAPADGGPMLQCFPRRKKSEVAVGDRVAYERTSADQGVIVEIGERRNLLYRSDQFKSKLFAANLDQLLIVLATEPYFSEDLLGRALIAAEANELKPIVVLNKIDVEAALPVARERLAPYRALGYDVLELSVKSAPDDARTQLAPRLAGHSTILLGQSGMGKSTLVNLLVPNAEAATREISAALNSGRHTTTFTRLYPLQDGGALIDSPGFQEFGLYHLTEGRLERAFPEFRPLLAHCRFYNCHHLHEPGCAILEALADGRIAPTRHALYAQLVHEASQIVR

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

314 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

34.406 kDa

MKRAPTKQPAKPAARGGERAQGRVIAAHGRHYIVAPADGGPMLQCFPRRKKSEVAVGDRVAYERTSADQGVIVEIGERRNLLYRSDQFKSKLFAANLDQLLIVLATEPYFSEDLLGRALIAAEANELKPIVVLNKIDVEAALPVARERLAPYRALGYDVLELSVKSAPDDARTQLAPRLAGHSTILLGQSGMGKSTLVNLLVPNAEAATREISAALNSGRHTTTFTRLYPLQDGGALIDSPGFQEFGLYHLTEGRLERAFPEFRPLLAHCRFYNCHHLHEPGCAILEALADGRIAPTRHALYAQLVHEASQIVR

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

313 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

34.31 kDa

MRSPGRPSVTSPPLRGEIVAAFGRHFLVKTADESTLTCVLRGKKSGAACGDWVEIYQTASEQGVIERILPRSALLYRSDLSREKLIAANATQVIIVVAPVPSFSEELINRCLVAAESQQLSVLIVLNKTDLLGPSKVALNGLSLYRELDYTLLPISARNDVKPLLPYLEDNLSVLVGQSGMGKSTIINALVPDAERATGDISPTLDAGRHTTTHARLYHLDRNARIIDSPGIQQFGLQHLSIEAIAWGFREFRPYIGKCKFNNCRHSGEPGCALANAMRESEVSVRRIDLYHKLIASLNTNRIPSSSSRTKIQ

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

313 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

36.095 kDa

MNSSTFEVLWGVNNIYSVVEVNTNTVYEGVIKGKFLNTREKEYSPLVPGDFVCGDIYDEHKVYIKERMERRNVFWRYNKKVALRQVIVSNIDNILIVSSATLPEFKNSFIDRTLIVAEEQGITPIILVNKVDEGINLRVDSFIKIYEYLGYRVIKTSVVTLQGIDEVKKIIKNSRTSFIGQSGVGKSSLINVIDLNASQAINEISYKYARGRHTTVYAVAFHSDNKILIDTPGIKEFGIEGLGYLELKYYFKEFKYFNDLCRFNSCLHINEPNCFVISQIGFKIAEARYNSYLKIFSELKRYKSYAREIFGKN

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

313 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

36.095 kDa

MNSSTFEVLWGVNNIYSVVEVNTNTVYEGVIKGKFLNTREKEYSPLVPGDFVCGDIYDEHKVYIKERMERRNVFWRYNKKVALRQVIVSNIDNILIVSSATLPEFKNSFIDRTLIVAEEQGITPIILVNKVDEGINLRVDSFIKIYEYLGYRVIKTSVVTLQGIDEVKKIIKNSRTSFIGQSGVGKSSLINVIDLNASQAINEISYKYARGRHTTVYAVAFHSDNKILIDTPGIKEFGIEGLGYLELKYYFKEFKYFNDLCRFNSCLHINEPNCFVISQIGFKIAEARYNSYLKIFSELKRYKSYAREIFGKN

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

313 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

33.789 kDa

MSVDEDNLLQGRVLSVHGLQSKVLGDNGVLYACAVRQVLKSLSTSQRNVIVAGDRVWFRSESRDGVSLKSEADGMIERVEPRTGMISRTSRGRQHVLVSNIDAMLIIASAEQPGIKPALIDRMILTAHQCQIEPIVIINKVDLIDLVDLQPLIGVYSSLGYRVLPTSAETGQNVAYLRALLKDRQTALAGQSGVGKSSLLNAVQPGLGLAIGAVSSDNDKGKHTTTASQLIPLADGGAVFDTPGIRQFQLWDISAGEVAGLMPDLRPYVSGCRYPDCLHLAEDDCAVKTAVADARIDARRYDAYCHLLEEELM

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

312 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

35.242 kDa

MNKNKSNKLKGIVVALKANFLIVEIDHKNFKDYSFDEFNGKIRLLCIRRSKLNYQGLFIDVGDIVGVESIDYKNKRAVVSDVEPRQSFLKRPAVANVTLVSICISADEPLFDMEQTSRFLLTAECANIEPLIILTKIDLITKNDLILYINKFKSWGYDCIPVSIHNSQGIDSLIERLRKTKLTVLAGPSGVGKTSLINHLIPTVSLPTSSVSKKLKRGTHTTRHVELFAIGNGSLLADTPGFNRPEIVCEPSDFAFLFPEFRTQLSNSQCKFRNCLHRDEPGCVIDKDLERYPFYRENLEEMINSPLPYQAG

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

312 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

35.309 kDa

MNKNKSNKLKGIVVALKANFLIVEIDHKNFKDHSFDQFYGKIRLLCIRRSKLNYQGLFIDVGDIVCVESIDYKNKRAVVSDVEPRQSFLKRPAVANVTLVSICISADEPLFDMEQTSRFLLTAECANIEPLIILTKIDLITKNDLILYINKFKSWGYDCIPVSIHNSQGIDSLIERLRKTKLTVLAGPSGVGKTSLINHLIPTVSLPTSSVSKKLKRGTHTTRHVELFAIGNGSLLADTPGFNRPEIVCEPSDFAFLFPEFRTQLSNSQCKFRNCLHRDEPGCVIDKDLERYPFYRQNLEEMINSPLPYQAG

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

311 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

34.59 kDa

MNETLSGVVTRVTGATYIVETGDGPKVRCRTVPSTVSENEGSNLVAVGDRVEFRPKASETEMAEGVIVRVEERRSVLERRREVRRNRSKEKEQVIAANIDQIVLITSFDDPPFNSRLVDRYLVFAESEHLPLLIVVNKIDLDEEGMVEEDLEVYRNLDCNICLVSAEDGRGIEELRELLRDRLSAFSGHSGVGKSTLINLLVGREELRTAETSGKTGKGVHTTTSSAMFQLPGGGYVIDTPGIREFNLAGITRENLRFYYTEFLRFMPECAFSSCSHTVEPGCAVIAAVESGRIDAERYESYLALLDSLDE

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

311 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

34.46 kDa

MKETLSGVVTRVTGASYIVETGDGLKVRCRTVPGTVSENEGSNLVAVGDRVEFRPKASETDMAEGVITRVEERRTALVRRREVRRNRSKEKEQVIVANIDQLVLITSFDDPPFNSRLVDRYLVFAESEKLPLLIVVNKIDLDEEGMVEEDLEVYRQLDCNICLVSAEDGRGIEELRELLRDRVSAFSGHSGVGKSTLINLLVGCEELRTAETSGKTGKGVHTTTSSAMFQLPGGGYVIDTPGIREFNLAGITRENLRFYYTEFLRYMPECTFSSCSHTVEPGCAVIAAVESGSIARERYESYLALLDSLAE

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

311 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

35.874 kDa

MKGLVIKNTGSWYQLKTDRGELIKAKLKGNFRLKGIQSTNPISIGDYVLIEKDLYGTAFISTIEDRKNYIIRRASNLSKQSHIIATNLDQAFLIVTVNYPITTTIFIDRFLVTTEAYRIPTLLFFNKTDLYNNHDMNYADILIHLYKSIGYSCYKIAATKDEDLLFMEKLLRGKITLFYGHSGVGKSTIVNRLIPNAKQKVQSISKHHNKGMHTTTFSKMLELPSSSGYIIDTPGIKGFGIFDIEKEEISHYFPDIFRFSPYCKFYNCTHQKEPACAVREAIKNHYISKSRYISYINILEDVDMNKYREAF

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

310 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

34.998 kDa

MRGLVIKNTGSWYTVRTEDGRDIESKIKGNFRLKDIKSTNPVAVGDRVVIDINKEGTAFITEIEERKNYIIRRASNLSKQSHIIAANLDQAMLIVTVNYPITTTIFIDRFLATAEAYRVPVKLVFNKIDRYNNEDQRALECLIELYTSIGYPCSTLCARTEEGLDALKADLKDKITLLSGHSGVGKSTIINKLVPGVNLRTGDISEYHNKGMHTTTFSEMIPLPGGGYLIDTPGIKGFGTIEMADAEISHYFRELFKYSEECRFNNCTHRHEPGCAVIQAVNDGLISESRYKSYLSILDDRMESKYREEF

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

310 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

35.894 kDa

MKKALVIRFLAGIYYIQDLDNQTILKAQKKGVLKKSNFIQDNQLKNNRDKMSIKVGDIVLYGMCYDKYLIYAILPRKNELKRPNIANIDQVLLVFSLVKPHFQTLLLDKFLLILQQHKLDVILVFSKIDLIEKEELEEIQQNMNYYFPFYTCYYVDSKQQIGIGVLKNIFEQKITVLAGQTGVGKSTLLKALIPDANLKTQEISESLGRGKHTTKNAQLYLFNNGFIADTPGFSKLDLGGFSYQNLKNFYPDFLKYVDNCYFGTNCLHLQETQCGVKEALTQGKIIPSRYSNYCYFMEEIKKEKKIYVKN

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

310 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

34.812 kDa

MKGLVIKNTGSWYQVKTDNGQLVECKIKGNFRLKGIRSTNPVAVGDRVQIILNQEGTAFISEIEDRKNYIIRRSSNLSKQSHILAANLDQCMLVVTVNYPETSTTFIDRFLASAEAYRVPVKILFNKVDAYDEDELHYLDSLITLYTQIGYPCFKISALTGEGVDTIREELKGRVTLFSGHSGVGKSTLINALVPGLEVKTAEISAYHNKGMHTTTFSEMFPVPGDGYIIDTPGIKGFGTFDMEEEEIGHYFPEIFKTSANCKYGNCTHRQEPGCAVRKAVEEHYISESRYTSYLSMLEDKEEGKYRAAY

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

310 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

35.097 kDa

MKGLVIKNTGSWYLVKTEDGRTIECKIKGNFRLKGIRSTNPIAVGDYVQIIINNEGTAFISEIEDRKNYIIRRASNLSKQSHILAANLDQCMLIVTINYPETSTIFIDRFLATAEAYRVPVKLIFNKTDRYNEDDTRYMDALINLYTYIGYPCFKVSALNNIGTDEVKKDLEGKVTLLSGNSGVGKSTLINAILPEQTLKTGEISDYHNKGMHTTTFSEMFPVDGGGYIIDTPGIKGFGTFDMEEEEVGHYFKEIFEYSAHCKYGNCTHRHEPGCAVRDAVEKHLISESRYTSYLNMLEDKEEGKYRAAY

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

310 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

34.782 kDa

MKGLVIKNTGSWYQVKTDDGQLVECKIKGNFRLKGIRSTNPVAVGDRVQIILNQEGTAFISEIEDRKNYIIRRSSNLSKQSHILAANLDQCMLVVTVNYPETSTTFIDRFLASAEAYRVPVKILFNKVDAYDEDELHYLDSLITLYTQIGYPCFKISALTGEGVDAIREELKGRVTLFSGHSGVGKSTLINALVPGLEVKTAEISAYHNKGMHTTTFSEMFPVPGDGYIIDTPGIKGFGTFDMEEEEIGHYFPEIFKTSANCKYGNCTHRQEPGCAVRKAVEEHYISESRYTSYLSMLEDKEEGKYRAAY

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

309 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

35.064 kDa

MHTGQIIQLLAGFYDVLTEDHKIVRTRARGNFRNQKTSPLVGDMVDFKESENDTGYITKIHTRENELVRPPLANIDQAVIVTAATEPSFSANLLDRQLVALAEKHIEAILYFSKTDLLSPTEFQDLQKIAGYYQKIGYQVIFPISSQPDADLIELKESFKNQLTIFMGQTGAGKSTLLNRIDSKLNIATGEVSQALNRGKHTTRKVSLIPIEDGLVADTPGFSTYAVFEMADTQLKEYFIDFKKLSQNCRFRECLHLNEPGCAVKAAVEDGSVLSSRYANYEQFIELIRNQKPEYKRKGYQKKDRRKKK

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

309 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

35.409 kDa

MLEINKDRIKGIVLALKANYYIVQIDTINLIPELFKKKIGDHNFRLLCTKRSRLSYKGHSVSVGDFVLIEAIDWTAETGVISFVEPRKNLITRPPVANVTDVIIVVSLLDPSFDLNQVSRFLMKAEETGLKVTIVLTKRDLIDEKILEKYDKKLQTWGYQPIPISIVNGEGIQKLSARLKSMKLGVLCGPSGVGKSSLINYLLPKISIPIGKLSKKLKRGRHTTRHVELFSIYSDSFIADTPGFNKPEFYTEPSQVPQLFPELRSQLLIKKCKFRNCMHLNEPDCAISRDWERYSNYKNFLQEMLNYHH

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

307 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

33.538 kDa

MPSEHPFSDGISTPNPKETMNDTAQITAGYGRRYIVRTPDGTTYEASTRKKRVDFACGDRVRISPVNAEQVVIEDFLPRQSLLYRQDAWKTKLIAANVTQLLIVTAAVPSPSVRLLQRALLAAEAAGIRAVIVLNKADLPETALWLEKLKFYETLGYPVIETRVLENADSLRPVLQGHSNILLGQSGMGKSTLTNALLGSQTARTGDISAALDSGKHTTTHARLYDLNGETQLIDSPGLQEFGLHHLQAADLPHYFPDFRHLVGQCRFHNCTHRAEPGCAFKAAAETGAASPERLAFLQGITDELLG

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

307 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

33.615 kDa

MPSEHPFSDGISTLNPKETMNDTAQITASYGRRYIVRTPDGTTYEASTRKKRVDFACGDRVRISPVNAEQVVIEDFLPRQSLLYRQDAWKTKLIAANVTQLLIVTAAVPSPSVRLLQRALLAAEAAGIRAVIVLNKADLPETALWREKLKFYETLGYPVIETRALENAGSLRPALQGHSNILLGQSGMGKSTLTNALLGSQTARTGDISAALDSGKHTTTHARLYDLNGETQLIDSPGLQEFGLHHLQAADLPRYFPDFRHLVGQCRFHNCTHRAEPGCAFKAAAETRAASPERLAFLQGITDELPG

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

307 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

33.599 kDa

MPSEHPFSDGISTPNPKETMNDTAQITASYGRRYIVRTPDGTTYEASTRKKRVDFACGDRVRISPVNAEQVVIEDFLPRQSLLYRQDAWKTKLIAANVTQLLIVTAAVPSPSVRLLQRALLAAEAAGIRAVIVLNKADLPETALWREKLKFYETLGYPVIETRALENAGSLRPALQGHSNILLGQSGMGKSTLTNALLGSQTARTGDISAALDSGKHTTTHARLYDLNGETQLIDSPGLQEFGLHHLQAADLPRYFPDFRHLVGQCRFHNCTHRAEPGCAFKAAAETRAASPERLAFLQGITDELPG

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

307 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

33.482 kDa

MPSEHPFSDGIPTPNPKETMNDTAQITASYGRRYIVRTPDGTTYEASTRKKRVDFACGDRVRISPVNAEQVVIEDFLPRQSLLYRQDAWKTKLIAANVTQLLIVTAAVPSPSVRLLQRALLAAEAAGIEAVIVLNKADLPETALWREKLKFYETLGYPVIETRALENAGSLRPALQGHSNILLGQSGMGKSTLTNALLGSQTARTGDISAALDSGKHTTTHARLYDLNGETQLIDSPGLQEFGLHHLQAADLPRYFPDFRHLVGQCRFHNCTHRAEPGCAFKAAAQTGAASPERLAFLQGITDELPG

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

307 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

33.617 kDa

MPSEHPFSDGISTPNPKETMNDTAQITASYGRRYIVRTPDGTTYEASTRKKRVDFACGDRVRISPVNAEQVVIEDFLPRQSLLYRQDAWKTKLIAANVTQLLIVTAAVPSPSMRLLQRALLAAEAAGIEAVIVLNKADLPETALWREKLKFYETLGYPVIETRALENADLLRPVLQGHSNILLGQSGMGKSTLTNALLGSQTARTGDISAALDSGKHTTTHARLYDLNGETQLIDSPGLQEFGLHHLQAADLPRYFPDFRHLVGQCRFHNCTHRAEPGCAFKAAAETGAASPERLAFLQGITDELPG

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

307 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

33.508 kDa

MPSEHPFSDGISTPNPKETMNDTAQITAGYGRRYIVRTPDGTTYEASTRKKRVDFACGDRVRISPVNAEQVVIEDFLPRQSLLYRQDAWKTKLIAANVTQLLIVTAAVPSPSVRLLQRALLAAEAAGIRAVIVLNKADLPETALWLEKLKFYETLGYPVIETRVLENADSLRPVLQGHSNILLGQSGMGKSTLANALLGSQTARTGDISAALDSGKHTTTHARLYDLNGETQLIDSPGLQEFGLHHLQAADLPHYFPDFRHLVGQCRFHNCTHRAEPGCAFKAAAETGAASPERLAFLQGITDELLG

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

307 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

35.22 kDa

MNYLEFEVIWGVNNIYSILELKSKLIYEGIFKGKVLETGCKEYSPLVPGDIVLGYIYGSRKVYIDKRASRKNILWRYNRKADLRQTIVSNIDNILIVNSANFPEMKNFFIDRVLVVAEEQNIVPIIVINKIDKGISQRVEEFSEIYKNLGYKVLKTSVKTFEGIKEIKEVLRNSRTSFIGQSGVGKSSLINLIDSKASQSVNEISHKYSRGKHTTVYAISFYSESGIIVDTPGIKEFGIETLPFENLRYYFKEFENFASLCKYKSCLHVSEPCCSVISSLGNGISKLRYESYLKILSELKNYKNYAR

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

307 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

35.395 kDa

MNYLEFEVIWGVNNIYSILELKSKLIYEGIFKGKILETGCKEYSPLVPGDIVLGYVYGSRKVYIDKRVSRKNILWRYNRKVDLRQAIVSNVDNVLIVNSANFPEMKNFFIDRVLVVAEEQNIVPVIVINKIDKGISQRVEEFSEIYKNLGYRVLKTSVKTFEGIKEVKEILRNSRTSFIGQSGVGKSSLINLIDSRASQSVNEISEKYSRGKHTTVYSISFHSENWIIVDTPGIKEFGVETLPFENLKYYFKEFENFASFCKYKSCLHVSEPHCSVTNSLGNGISKPRYESYLKILSELKNYKNYAK

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

307 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

35.257 kDa

MNYLEFEVIWGVNNIYSILELNSKLIYEGIFKGKVLETGCKEYSPLVPGDIVLGYIYSSRKVYIDKRLSRKNILWRYNKKADLRQTIVSNIDNVLIVSSANFPEMKNFFIDRVLIVAEEQNIVPIIVINKIDKGISQKAQEFSEIYENLGYKVLKTSVKTYEGIKEVKEVLKNSRTSFIGQSGVGKSSLINLIDSRASQSVNEISHKYSRGKHTTVYSISFHSDSGIIVDTPGIKEFGIETLPFENLKYYFKEFENFASFCKYKSCLHVSEPYCSVTSSLDNGISKLRYESYLKILSELKNYKNYAR

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

307 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

35.257 kDa

MNYLEFEVIWGVNNIYSILELNSKLIYEGIFKGKVLETGCKEYSPLVPGDIVLGYIYSSRKVYIDKRLSRKNILWRYNKKADLRQTIVSNIDNVLIVSSANFPEMKNFFIDRVLIVAEEQNIVPIIVINKIDKGISQKAQEFSEIYENLGYKVLKTSVKTYEGIKEVKEVLKNSRTSFIGQSGVGKSSLINLIDSRASQSVNEISHKYSRGKHTTVYSISFHSDSGIIVDTPGIKEFGIETLPFENLKYYFKEFENFASFCKYKSCLHVSEPYCSVTSSLDNGISKLRYESYLKILSELKNYKNYAR

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

307 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

32.886 kDa

MTTSTTGVVVQGTGGVWEVYTEQGERFSASMRGRLKHEAHGALKLAVGDRVTIARDAQHAETWAITDIHPRTSKLARRMPGGRYGERIVVANLDQVLVVFAAARPDPHPRMLDRFLVIAEANGLSARIVINKADLVSPEVSAALFADQMAAGYPVHHTSIHTGEGLEALRDEVEHRSSALSGPSGVGKSSLMNALFPGLDLRTAAVSDAVNKGRHTTVGAMLHPLPHGGFIADTPGLREVGLWGIEAGQVASCFPEFRPLLSACRFADCIHTVEPGCAVREAVEAGDVSPGRYESYVKLRDELMGRS

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

307 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

34.967 kDa

MIKNGRIVKSLAGFYDVESEGEVYQTRARGNFRKKGMKPVVGDFVEFSTEENSEGYILKIGERKNSLIRPSIANIDQAVIIMSTVSPNFSLNLLDRFLVFLEHKNIHPMIYISKLDLLTEMQEGSDKNKKTFNQLTDYEQIKSDYEQIGYDVFFDAEHLVSNLAGKVTVFMGQTGAGKTTLLNKIAPEMQLATGETSEKLGRGRHTTRHVEFFELAGGLIADTPGFSSLDYEVTNRPDLNAAFPEILRISHDCKFRECTHTHEPSCAVKLALENHEILESRYDNYLQILDEINHTRETYEKKRKKQG

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

307 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

35.207 kDa

MKGIIYKSTGSWYLVKAEDGTYYNARLRGKFKHLDLKVTNPLSVGDFVDMNIDPLTPTEAMIFNIEPRTNYIIRRSSHKTAFGHLIACNIDQSILLVTLKQPKTSIGFIDRFLISCEAFRIPAVIVFNKSDLYNEALMEEYLYLKDVYEPLGYRCILTSMEKENGLDELMPLLQNKISVVSGHSGVGKSTLINKIFPQLDIKTDIISDHSQKGKHTTTFAEMYDLNETSKVIDTPGIKELGLFEIENDVLSHYFPEMRSLMGQCRFHNCKHTNEPGCRVKEYVEAFKIAPTRYESYCSIIFEKDTHR

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

306 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

35.157 kDa

MEKALVLRFLAGVYYIKDLETQIILEAKKRGKLKTPDIKTTQKENSSASDFIIKVGDIVFYELSCDTYLIQSILPRKNELKRPNVANIDQVLLVFSLVKPNFQFLLLDKFLLILEQQKLDVVLVFSKIDLLEPENLTTMQQQLSYYQKFQPFYYINSKQKIGIDALKHIFANQITVLAGQTGVGKSTLLKALIPDAKLKTQEISESLGRGKHTTKNAQLYEFNGGFIVDTPGFSKLDLTTFCPRTLKNFYPDFVEHVCDCFFGESCLHLQEEKCGVKKSLENGKILPSRYQNYVSFYEEIKNQLKY

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

306 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

35.204 kDa

MEKALVLRFLAGVYYIKDLETQIILEAKKRGKLKTLVIKTTQKENSSASDFIIKVGDIVLYELSCDTYLIQSILPRKNELKRPNVANIDQVLLVFSLVKPNFQFLLLDKFLLILEQQKLDVVLVFSKIDLLEPENFKTMQQQLSYYQKFQHFYYINSKQKIGIDALKHIFANQITVLAGQTGVGKSTLLKVLIPDAQLKTQEISESLGRGKHTTKNAQLYDFNGGFIVDTPGFSKLDLTTFSPRTLKNFYPDFLEHVCDCFFGESCFHLQEEKCGVKKALENGQILPSRYQNYVIFCEEIKNQPKY

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

305 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

34.583 kDa

MQLGIILKGIGGFYYVKQEKTEDIFECKPRGVFRKNSVTPLPGDRVGFSIIDGDKKLGNIDEILPRSSELVRPAVANVDQIAIIVAAKAPNPDYMLLDKLLITAETRNIRVLICVNKIDLDDDTAKIVRNAYSPAGYDVIEISSVRNIGYKRLKEELKGHITVFAGQSGVGKSTILNHIMESWVMETGSVSNKIERGKHTTRHAELLELKYGGYVADTPGFSSFEIIDIPYNQLERYYPEFLPYINTCRFNSCSHITEPGCRVIEALERSEIDNNRYQRYIQLYKALKDIPQYKGKKTESRRVIK

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

304 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

36.076 kDa

MKKALVIKFFMGNYLISDIETKDKITAQVKGKLKNYDTHKKELFIIKVGDIVIYENYLDRYLISEVLERHNELNRPNIANFNQVILVFSLYKPRFQFRLLDKFLLILNKYKLKIILIFTKIDLITKKKFLIIQKKISYYENFYRIYYVNSKNKNSTHHLMDIFSNKITVLAGQTGVGKSTFLNSLKPSLQLKTQEISKKLGLGKHTTKNAQLYEFNGGYIADTPGFSKLDLTIFDYEELKFFYPDFLLYSDKCYFKKDCSHIKEINCGVKKALKLSLIPDWRYDNYLKFIEKIQEQKKLNYNKK

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

304 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

33.686 kDa

MVVLDQPAQSGMVVALQANYLEVELDQVSELIPSRLLCTRRTRLSHRGEAVYVGDRVRVEAIDVSHARAVVADVEPRVSFLTRPPVANASTVVVALAVDQPAFDPDQASRFLLTAERTSLAVQLVLTKTDLLEPEALERLRVRLQAWGYPPLLVSTFSGLGLSELKQRLAESSLSVLCGPSGVGKSSLLNALIPELDLRIGSVSGRLQRGRHTTRHVELHHLGAKARVADTPGFNRPDLPDDPRNLEVLFPELRVQLEQHPCRFRDCLHRDEPGCGVTRDWERYPIYRRAVEDLLGLSRPSRGG

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

304 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

32.936 kDa

MADTARSVASGMVVALQANYLEVELDVAPDGCPGRLLCTRRTRLSHRGEAVYVGDRVRVEAIDPGQGRAVVAEVEPRHSFLTRPPVANVSLVAVVLAVEQPSFDPDQASRFLLTAERTGLEVILLLTKTDLLSAAALERLVTRLQGWGYDPLAFSSAAGTGIDALRQRLAGAQLSVLCGPSGVGKSSLLNQLCPDLQLRTAAVSGRLQRGRHTTRHVELFPLGPSARVADTPGFNRPDLPEDPQELGVLFPELRKQLDPWPCRFRDCLHRGEPGCGVSTDWERYSLYEAALIEQSSLSRPSRGG

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

303 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

34.761 kDa

MRAKIISVVANNFYVHLYDLKIQIKAIPKGIFKHNSHELKPMVGDDVEVELIGNTYLITKIYERYNQLIRPKVANIDIVLIVVSIVQPDLNTLSLNKYLAFYEARNIKNVLIGLSKYDLANNHLKQKINKLILDYKKNNYAVFILTKENDILLLKEKIKSKTLCLAGNSGVGKSTLINKLDPSIQQRTQEISHFLNRGKHTTTSTKLISFANGFLVDTPGFGNLEVNLTKNEMANAFNDFANYARFCKFSNCLHIEEPECAIKKAVDEKLIVNWRYDDYLKIIKELPNDVLKIKTRAQNRKCK

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

302 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

34.29 kDa

MTGKIIKGIAGFYYVYVEETKEAKETATGGTLYECKAKGTFRKQKIKPLVGDTVDIAVLDEEKHIGNVERILPRKNELIRPAVSNIDMALVIFASAKPDPNFNLLDRFLCMMEYQHVPVTICFNKKDLITPQKQQELKSIYEPAGYRVMFTSTKTGEGIDEIKHVLEGRTTTVAGPSGVGKSSIINCLQDDVQMETGHISEKIERGKHTTRHSEIIPIKDGTYIMDTPGFSSMDVPGFEKEDLWTCYPEFVEYEPYCRFQGCSHINEPDCGVKEALSEGKISQVRYDNYKLLYEELKNRQKY

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

302 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

34.643 kDa

MGKKELKRGLVVDREAQMIGVYLFEDGKTYRGIPRGKVLKKTKINAGDYVWGEVVDPNTFAIEEVEERKNLLIRPKVANVDRVIIVETLKMPEFNNYLLDNMLVVYEYFKVEPVIVFNKIDLLNEEEKKELERMDSIYRDAGYDVLKVSAKTGEGIDELVDYLEGFICILAGPSGVGKSSILSRLTGEELRTQEVSEKTERGRHTTTGVRLIPFGKGSFVGDTPGFSKVEATMFVKPREVRNYFREFLRYQCKYPDCTHTNEPGCAVKEAVKNGEISCERYKSYLKIIKVYLEEIKELCRED

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

302 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

34.574 kDa

MRAKIISVVANNFYVHLYDLKIQIKAIPKGIFKHNSHELKPMVGDDVEVELIGNTYLITKIYERYNQLIRPKVANIDIVLIVVSIVQPDLNTLSLNKYLAFYEARNIKNVLIGLSKYDLANNHLKQKINKLILDYKKNNYAVFILTKENDILLLKEKIKSKTLCLAGNSGVGKSTLINKLDPSIQQRTQEISHFLNRGKHTTTSTKLISFANGFLVDTPGFGNLEVNLTKNEMANAFNDFANYARFCKFSNCLHIEEPECAIKKAVDEKLIVNRYDDYLKIIKELPNDVLKIKTRAQNRKCK

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

301 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

33.449 kDa

MEKGRIIRSLSGYYDIETDKGKIQRTRARGEFRKSGQKPIVGDFVDFESENDDGLIWKIYPRINALVRPPIANIDIAVIVTALKEPNFAANLLDRQLVALEAAHVKPVIYFSKADLLTDEAYAAITIIAEDYRQIGYTVLLPASNNNVVARQALQSLLDGRVSVFMGQTGAGKSTLLNQLSPKLGLETGIVSKALSRGKHTTRQVTLIKVNDALIADTPGFSSYEVFDFSAEALDDYFPEFVAVRDGCRFRGCLHLNEPACAVKEAVSLGAIPESRYNSYKAFYELIKSQKPKYKTDNRNF

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

301 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

34.471 kDa

MRAKITSVIVNNFYVYIYDLKIETKAIPKGIFKHDSHELKPMVGDDIEVELVDGVYLIVKIYDRYNQLIRPKVANVDIVLVVASIVQPDLNTLTLNKYLAFYEARNVKNVAIGLSKYDLASDSLKQKVDQLILDYQRNNYKVFVLTNEHDISLLKKFIKKHTLCLAGNSGVGKSTLINKLDPSIKQRTQEISQFLNRGKHTTTSTKLISFANGFLVDTPGFGNLEVNLTKNEMANAFSDFANYARFCKFSNCLHIDEPHCAIKKAVNDDQIVNWRYDDYLKIMKKLPNDVLEIKTRNQNKK

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

300 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

32.737 kDa

MSSNQAEGLIIAAHGRHYTVELADGSLRQCFPRGKKNGPAVGDRVRITPQGRDEGAIEAVLPRRNLLFRSDEMRVKQFAANVDQLLIVVAVEPTFADDLTGRSLAGAWSADIEPVIVLNKIDLPNGLDAARARLEPLRRLGVPVIELSAQDHAMVHERLAPRLAGRTSLLLGQSGMGKSTLLNTLVPHAQAATREYSAALDMGRHTTTSTRLYHLPEPGGDLIDSPGFQAFGLQHLNGEQILRGFPEFAPHIEHCRFYNCTHRHEPGCGVLAALQAGQIDAGRYALYLRILDENAAARPY

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

300 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

32.737 kDa

MSSNQAEGLIIAAHGRHYTVELADGSLRQCFPRGKKNGPAVGDRVRITPQGRDEGAIEAVLPRRNLLFRSDEMRVKQFAANVDQLLIVVAVEPTFADDLTGRSLAGAWSADIEPVIVLNKIDLPNGLDAARARLEPLRRLGVPVIELSAQDHAMVHERLAPRLAGRTSLLLGQSGMGKSTLLNTLVPHAQAATREYSAALDMGRHTTTSTRLYHLPEPGGDLIDSPGFQAFGLQHLNGEQILRGFPEFAPHIEHCRFYNCTHRHEPGCGVLAALQAGQIDAGRYALYLRILDENAAARPY

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

300 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

32.737 kDa

MSSNQAEGLIIAAHGRHYTVELADGSLRQCFPRGKKNGPAVGDRVRITPQGRDEGAIEAVLPRRNLLFRSDEMRVKQFAANVDQLLIVVAVEPTFADDLTGRSLAGAWSADIEPVIVLNKIDLPNGLDAARARLEPLRRLGVPVIELSAQDHAMVHERLAPRLAGRTSLLLGQSGMGKSTLLNTLVPHAQAATREYSAALDMGRHTTTSTRLYHLPEPGGDLIDSPGFQAFGLQHLNGEQILRGFPEFAPHIEHCRFYNCTHRHEPGCGVLAALQAGQIDAGRYALYLRILDENAAARPY

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

299 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

34.037 kDa

MQTGQIIRALSGFYDVQSEHKIYRTRARGNFRKRKITPLVGDFVEFESESQTESGYILEILDRKNEMIRPPVANIDQAVVIVSAVEPDFSLNLLDRFLIYLESLNIQGLVYLTKTDMISDEKYQEIKQYLDYYEKVGYPTFAPRTAFTPEIIQAIEDTFPDKTTVFTGQTGAGKSTLLNHIDPKLNLATAEISQSLNRGKHTTRHIELIPLNDGLVGDTPGFSSLGILNVTSETLVSRYPEFREIGQDCKFRTCQHVMEPKCAVKAAVDAGEIMQSRYTNYLQFRAELKDIRPVYKKSK

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

299 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

33.105 kDa

MSEAVGIVVALQANYLEVELDQAPEQGLSRLLCTRRTRLSHRGETVHVGDRVRVEAIDPVQARAVVSGVEPRCSWLTRPQVANVSLVVVALAVDQPAFDPDQASRFLLTAERTGLPVQLLLTKGDLMEEHQRFALVERLMGWGYDSLVVSSQTGEGVEVLSQRLKDTELAVLCGPSGVGKSSVLNCLMPHLALRVGAVSGRLQRGRHTTRHVELFPIAPGSRVADTPGFNRPDLPDDPSELGMLFPELRVQLSPWPCRFRDCLHRQEPGCGINREWERFEFYKDALQECSDLSRPSRAG

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

298 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

33.677 kDa

MPEGKIIKALSGFYYVLDESQESGKVVQCRARGIFRKNKITPLVGDYVVYQADNDKEGYLLEVKERTNELVRPPISNVDQAVLVFSAAEPTFSTSLLDRFLVLVEANHIEPIICITKMDLLKTDEERETIMAYADDYRQIGYEVHLTSTIEGDGIEKLTPHFHNKITVFAGQSGVGKSSLLNAMSPELALKTDDISSHLGRGKHTTRHVELIRTANGLIADTPGFSSLEFTGIEAEDLGLYFLDIRDRSGDCKFRGCLHVKEPGCAIKDAVEHDQIKEYRYQHYLEFLTEIKDRKPRY

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

298 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase with a low level of activity and slow catalytic turnover, does not act on ATP (PubMed:16485133). GTPase activity is stimulated by the presence of 30S or 70S ribosomes, phosphorylation increases stimulation (PubMed:22544754). Depletion results in increased sensitivity to protein synthesis inhibitors that block the peptide channel or peptidyl transferase center on the ribosome, suggesting this protein functions in conjunction with the ribosome in vivo (PubMed:15828870). Decreasing levels of protein lead to an increase in free 30S and 50S ribosomal subunits and a decrease in assembled 70S ribosomes (PubMed:15828870). Suggested to serve as a specific transcription factor for proteins involved in late stages of peptidoglycan synthesis (PubMed:18344364).

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

33.797 kDa

MPEGKIIKALSGFYYVLDESEDSDKVIQCRGRGIFRKNKITPLVGDYVVYQAENDKEGYLMEIKERTNELIRPPICNVDQAVLVFSAVQPSFSTALLDRFLVLVEANDIQPIICITKMDLIEDQDTEDTIQAYAEDYRNIGYDVYLTSSKDQDSLADIIPHFQDKTTVFAGQSGVGKSSLLNAISPELGLRTNEISEHLGRGKHTTRHVELIHTSGGLVADTPGFSSLEFTDIEEEELGYTFPDIREKSSSCKFRGCLHLKEPKCAVKQAVEDGELKQYRYDHYVEFMTEIKDRKPRY

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

297 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

33.846 kDa

MVYLKGQIRKALSGFYYVYADGETYQTRARGNFRNRKITPLVGDEVLFESDNLTDGYVLEILPRRNELVRPPVANVDLGVVVMSMVSPNFSFNLLDRFLVSLEYKDIEPVIYLTKVDLLDEPQRQQVTEIKQIYEALGYAVIASEDVEATKELERFFPERLTVFMGQSGAGKSTLLNQISPELQLATAEISQSLGRGKHTTRHVELIPLYDGLVADTPGFSAIDFLEMEAVELPKQFPEFVAAASHCKFRECMHHKEPGCEVKRQVEAGTIATSRYENYLQFLMEIENRRPVYKKKS

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

297 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

33.911 kDa

MNKAQGTIVSAISGYYDVEIENEVVRTRARGVFRDRKQKPLVGDRVVVQLDNQGMNYLIEILPRTNEIGRPAVANVSKVLLVISAVEPDFSLELLDRYLTFFAWKNVGVVIYLSKADITPTEKLKAIKCKLDYYQKIGYSVFEDAEELERQLPTMIQKDQIWTLAGQSGAGKSTLLNKLENEANQETGAISTALNRGKHTTRQVKLFKYSSGFIADTPGFSAIDLFKIKVDELENYFYDLKDASVKCKFRRCQHIKEPGCEVKKLIEEGKIAKSRYDSYLKIRQEISENRMPEYLKK

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

297 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

33.853 kDa

MKKAEGTIISAISGYYDVEIDNKVVRTRARGVFRDRKQKPLVGDRVVVQLDDQGMNYLIEILPRINEIGRPAVANVSRVLLVISAVEPDFSLELLDRYLTFFAWKNVGVVIYLSKSDITSSERLKDIQTELEYYQRIGYPVFEDAEKLENELPKMIDKDQIWTLAGQSGAGKSTLLNQLESEAKQVTGAISTALNRGKHTTRQVTLFKYGSGFIADTPGFSAIDLFKIKVDDLRNYFYDLKEASANCKFRGCQHIKEPGCEVKKLVEEGKIARSRYESYLKIRQEISDNRMPEYLKK

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

296 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

33.115 kDa

MPEGKIIKALSGFYYVLDESQDKIIQCRGRGIFRKNKITPLVGDYAVYQAENDKEGYLLEIKERTNELIRPPISNVDQAVLVFSAVQPAFSTSLLDRFLVLVEANGIHPIICITKMDLAADGESKEAILSYVKDYQAIGYDVYVTSSKENSGLTGIVKHFENKTTVFAGQSGVGKSSLLNAISPELELKTNEISTHLGRGKHTTRHVELIHTSGGLVADTPGFSSLEFTGIEEEELGSTFPEIREISASCKFRGCLHLKEPKCAVKQAVEEGEIQPYRYEHYKEFMQEIKERKPRY

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

296 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

33.657 kDa

MKLAQGTVVGLIAGYYDVETATGIVRTRARGVFRQKKQKPAVGDRVEIQIDDKGMSYLVEILPRINRIGRPAVANVSHVLLVISAVEPDFSLELLDRFLTFFSWQKVNVTIYLSKADLISEQRLNEIKESLDYYQKIGYPVFIDYHHLEEKIGDMIKDNQIWTLAGQSGAGKSTLLNHLKKDANQTTGAISTSLNRGKHTTRKVELFKLGHGFLADTPGFSSIDLTPIKLNELCNYFIEFKRASKKCKFRGCQHIKEPGCEVKKLLEEGKILHSRYDDYLAMRTEINEGRMPEYLK

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

296 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

33.202 kDa

MKNGTIQQSLSGFYDIWSGGKLYRTRARGNFRKRGLKPVVGDQVEFEAENQREGYLLKILPRKNQLVRPMVANVDLAVVVTAVKEPNLSTNLLDRQLVALESQGIDPVIYFSKTDLLSDQEADALMLVVKGYQMIGYPVLYQRPPFGEEALGELRKILTGKVVTMMGQTGAGKSTLLNHLAPDLNLATGEISQALKRGRHTTRKVSLMQVGDALIADTPGFSSYEDFQMTVEELPHFFPEMQALAPECKFRGCLHIKEPSCAVKNALKHGKIMNSRYDNYLQFHELIANQKPNYQK

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

296 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

33.404 kDa

MKLAEGTVVGLIAGYYDVETAAGIVRTRARGVFRQKKQKPAVGDRVEIKIDDQGMSYLVKILPRLNRIGRPAVANVSHILLVISAVEPDFSLELLDRFLTFFSWQKVKVTIYLSKTDLLKGDKLAKIKEDLAYYQKIGYPVFTDYHDVEVKIPQMIKEGQIWTLAGQSGAGKSTLLNHLKKDANQVTGAISASLNRGKHTTRKVELFKLGEGFLADTPGFSSIDLTPIKLNELCNYFVEFKRASSKCKFRGCQHLKEPGCEVKKLLEEGQIMQHRYDDYLAMRTEISEGRLPEYLK

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

296 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

33.257 kDa

MKTGIIQQSLSGFYDVIADEKIYRTRARGNFRQRKIKPVVGDHVEFSAENQQEGYLLKILPRRNQLVRPPVANVDMAVVVTSAKEPAFSANLLDRQLIALEAQDVTPLIYFSKTDLLTDDEYQQLLPTIEGYRKIGYQVYAAREPFDSDQLANLMEGLKGNIVTMMGQTGAGKSTLLNHLAPQLKLATGEISQALQRGRHTTRKVSLLDVNGALIADTPGFSSYETFDMTVNDLPQLFPEMAKISADCKFRGCLHIKEPQCAVKEAVNNGIIMKSRYNDYLQFHELIANQKPNYKK

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

296 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

33.257 kDa

MKTGIIQQSLSGFYDVIADEKIYRTRARGNFRQRKIKPVVGDHVEFSAENQQEGYLLKILPRRNQLVRPPVANVDMAVVVTSAKEPAFSANLLDRQLIALEAQDVTPLIYFSKTDLLTDDEYQQLLPTIEGYRKIGYQVYAAREPFDSDQLANLMEGLKGNIVTMMGQTGAGKSTLLNHLAPQLKLATGEISQALQRGRHTTRKVSLLDVNGALIADTPGFSSYETFDMTVNDLPQLFPEMAKISADCKFRGCLHIKEPQCAVKEAVNNGIIMKSRYNDYLQFHELIANQKPNYKK

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

295 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

33.703 kDa

MERIQGRIVRGIAGFYYVATERGIIECRARGKFRKDNIIPLVGDIAEVQLVNEKEGYILEILPRKNQLVRPPVANVDQAIIVFAISKPEINRVLLDKMIVVAEINKIEPVVCINKVDMEKREEVENLINVYRKIGYKAVGTSAVTGEGMEELKSYLKDKISFFAGPSGVGKSSLINLIQSNIRLKTGELSEKLGRGRHTTRSVEFLPLDFGGYVLDTPGFTALEIDIPKEELRNYFREFIEFQENCRFNSCLHVNEPDCAVTEAVDEGIIDRQRYISYLTLLREVKEKEKRRYKN

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

295 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

33.445 kDa

MKTGRIIRSLSGYYDIQLPSGDIQRTRARGEFRKSKQKPLVGDFVDFESENDEGFIWAIHERENFLVRPPIANIDIAVIVTAAKEPDFAPNLLDRQLVALEAANVRPLIYFSKMDLLEKSEHEKINHVANYYQSIGYDVIFSDSKSAFEALKMMLKDHVSVFMGQTGAGKSTLLNHLSPQLGLETGEVSKALSRGKHTTRQVTLIEVDEALIADTPGFSSYEVFDFPVEELDDYFPEFVEKRQDCRFRGCLHLNEPGCAIKEAVAVGTITQSRYNSYKAFYELIKAQKPKYKTDN

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

295 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

33.642 kDa

MNLRRRGIVVSFHSNMVTVEDEETGERILCKLRGKFRLQNLKIYVGDRVEYTPDETGSGVIENVLHRKNLLTKPHVANVDQVILVVTVKMPETSTYIIDKFLVLAEKNELETVMVINKMDLYDEDDLRKVRELEEIYSGLYPIVKTSAKTGMGIEELKEYLKGKISTMAGLSGVGKSSLLNAINPGLKLRVSEVSEKLQRGRHTTTTAQLLKFDFGGYVVDTPGFANLEINDIEPEELKHYFKEFGDKQCFFSDCNHVDEPECGVKEAVENGEIAESRYENYVKMFYELLGRRKK

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

295 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

33.522 kDa

MILRRRGIVLSFHSNMVTVEDEETGERLLCKLRGKFRLQNLKIYVGDRVEYTPDGTGSGVIENVLHRKNLLVKPHVANVDQAILVVTVKMPETSTYIIDKFLVLTEKNELETVLVINKMDIYDEEDLEKVKELERIYSKLYPIVKTSAKTGMGIEELKKYLKGKISTMAGLSGVGKSSLLNAINPGLKLRVSEVSQKLQRGRHTTTSAQLLRFDFGGYVVDTPGFANLEIGDIEPEELKYYFKEFNEKQCFFSDCNHIDEPECGVKEAVENGEIAESRYENYVKMFHELLGRGKS

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

295 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

33.585 kDa

MSLRRRGIVVSFHSNMVTVEDEETGERILCKLRGKFRLQNLKIYVGDRVEYTPDETGSGVIENVLHRKNLLTKPHVANVDQVILVVTVKMPETSTYIIDKFLVLAEKNELETVMVFNKMDLYDEADLKKVRELEEIYSELYPIVKTSAKTGMGIEELKEYLKGKISTMAGLSGVGKSSLLNAINPGLKLRVSEVSEKLQRGRHTTTTAQLLKFDFGGYVVDTPGFANLEISDIEPEELKNYFKEFGDKQCFFSDCNHVDEPDCGVKEAVENGEIAESRYENYVKMFYELLGRRKK

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

294 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

33.449 kDa

MPKGTIVKALSGFYYVQNEDGLFQCRGRGNFRNRNIKPLVGDEVVFEAENKTDGYVLEIMERKNELLRPPIANVDRAILVFSAAEPTFSPLLLDRFLVHVEANGIEPLIVISKIDLLTEEELETIKQYRNDYEQLGYKVYLTSTIEQLGLDAIRKEFDDHVSVIAGQSGVGKSSLLNAINPALDIETNQISSHLGRGKHTTRHVELIPFGSGLVADTPGFSSLDFIDMEPEELSHYFPEMRDRLPSCKFRGCTHTQEPKCAVKEALAQGEIREFRYEHYVTFLEEVKTQHKRRF

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

293 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

33.189 kDa

MPEGLIVKALSGFYYVQSEGALIQCRGRGVFRKRKQTPLVGDYVEFEAENETDGYVMAIKERKNQLNRPPIANVDQAILVFSAKEPDFHTLLLDRFLVHIEQHDIKPVLIISKTDLLEASERDALTRQVAMYEQIGYPVLYTSTKQADDPSELLPLLANQVSVIAGQSGVGKSSLLNALAPEAKIETNEISRHLGRGRHTTRHTELLPIGEGLVADTPGFSSLEFTDMEAEDLRFCFPEFLSLMDDCKFRGCLHDKEPKCAIKDAVETGEVDSFRYKHYLQFLHEIQDQKRRY

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

293 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

32.761 kDa

MAEGQIIKALSGFYYVLSEGRVFQCRGRGVFRKKKVTPLVGDRVVFQATSETEGYILEIGERQNELVRPPIANVEQAILVFSAVSPDFSAKLLDRFLVLVESKRITPIIVISKIDLLDGESKEEIARYVHDYRRIGYDVIETSAVTKGGLDELALRLRGRVSVVAGQSGVGKSSLLNALRPDLRLKTGDISTHLGRGKHTTRHVELLEVAGGLVADTPGFSALEFNQIELDELPHYFPEFRTYGEGCKFRGCLHIAEPKCAVREAVEAGEIPSYRYDHYVSFVAEMKERKPRY

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

293 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

33.375 kDa

MAEGKIIKALSGFYYVLSEGKVFQCRGRGVFRKQKITPLVGDHVEFQATSETEGYIMNIRERKNWLVRPPIANVEQAILVFSAVEPDFSTRLLDRFLVLVESKHIRPIIVVNKMDLVDDQTKPTMEQYIRDYRQIGYDVIETSTITKLGVEQLLSYLEGHISVFAGQSGVGKSSLLNALRPDLQLKTNDISTHLGRGKHTTRHVELLEIGGGLVADTPGFSALELDDIELEELPLYFPEFCERSEECKFRGCLHIAEPKCAVREAVESGKIPSYRYENYISFVEEIKERKPRY

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

293 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

32.491 kDa

MAEGQIIKALSGFYYVLSEGKVFQCRGRGVFRKQKVTPLVGDRVVFTATGEAEGYILEICERQNELVRPPVANVEQAILVFSAVSPDFSAKLLDRFLVLVESKNITPVIVISKIDLLDGGMKETIAQYVRDYRHIGYEVIETSTVTKEGLDELMSHLCGRVSVVAGQSGVGKSSLLNALRPDLQLKTGDISTHLGRGKHTTRHVELLAIAGGLVADTPGFSALEFDHIELDELPYYFPEFRAYGEGCKFRGCLHVAEPKCAVREAAEAGDIAPYRYDHYLSFVAEMKERKPRY

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

293 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

33.132 kDa

MPEGKIVKALSGFYYVQHEEGITQCRGRGVFRKNKITPLVGDQVVFQADNPSEGYVLEVFDRKNELVRPPIANVDQAILVFSAVEPDFNPGLLDRFLVLIEYHNIKPIICISKMDLVDEKMRETVEAYANDYREMGYDVLFTSINTSESIDILKPFLEGCVSVVAGQSGVGKSSMLNVLRPELELKTNDISSHLGRGKHTTRHVELIAIGSGLVADTPGFSSLDFIDIEVEDLTYCFPELKEASQYCKFRGCTHLSEPKCAVKAAVEEGKITEYRYKNYKQFVEEIRERKPRY

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

293 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

33.148 kDa

MPEGKIVKALSGFYYVQHEEGITQCRGRGVFRKNKITPLVGDQVVFQADNPSEGYVLEVFDRKNELVRPPIANVDQAILVFSAVEPDFNPGLLDRFLVLIEYHNIKPIICISKMDLVDEKMRETVESYANDYREMGYDVLFTSINTSESIDILKPFLEGCVSVVAGQSGVGKSSMLNVLRPELELKTNDISSHLGRGKHTTRHVELIAIGSGLVADTPGFSSLDFIDIEVEDLTYCFPELKEASQYCKFRGCTHLSEPKCAVKAAVEEGKITEYRYKNYKQFVEEIRERKPRY

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

293 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

33.303 kDa

MPEGKIIKALSGFYYVQHEEGITQCRGRGVFRKNKITPLVGDQVVFQAENQNEGYVLEVFERKNELVRPPIANVDQAILVFSAVEPDFNPGLLDRFLVLIEYHNIKPIICISKMDLVDEPMRKMVESYANDYREMGYAVLFTSVHAAESIEILKPFLEECVSVVAGQSGVGKSSMLNVLRPDLELKTNDISSHLGRGKHTTRHVELISIGSGLVADTPGFSSLDFIDIEVEDLTFCFPELKEESQYCKFRGCTHLSEPKCAVKAAVEEGRIADYRYEHYKQFVEEIRERKPRY

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

293 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

33.133 kDa

MPEGKIIKALSGFYYVQHEEGVTQCRGRGVFRKNKITPLVGDQVVFQADNPTEGYVLEVFDRKNELVRPPIANVDQAILVFSAVEPDFNPGLLDRFLVLIEYHNIKPIICISKMDLVDEKMKATVEAYANDYREMGYDVLFTSINTSESIDILKPYLENCVSVVAGQSGVGKSSMLNVLRPELELKTNDISSHLGRGKHTTRHVELIAIGSGLVADTPGFSSLDFIDIEVEDLTYCFPELKEASQYCKFRGCTHLSEPKCAVKAAVEEGKITEYRYKNYKQFVEEIRERKPRY

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

292 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

33.764 kDa

MKGTIIKGIGGFYYIKIDNSEEIIECKARGKFRHTELTPMIGDYVEISIDKNNKGAIEKIYERRSELFRPAVANVTQALVVFSFKNPDINIDLLNKFLLLCEYNNLKAIVCFNKMDLVNKEDYKDIISMIEQAGYDIIFLNAKEERNMDIIKKLIKDNVTVFCGPSGVGKSTMLNKIIGKETMITGNISEKLKRGKHTTRHSELIYVDEGLLVDTPGFSSLDINFMEKEDLLHCIPEFRDFIGECKFTGCLHHREPNCAVKKAVEEGHIHKDRYNFYIKTLEEFMNRRKKKW

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

292 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

33.784 kDa

MKGTIIKGIGGFYYIKIDNSEEIIECKARGKFRHTELTPMIGDYVEISIDKNNKGAIEKIYERRSELFRPAVANVTQALVVFSFKNPDINIDLLNKFLLLCEYNNLKVIVCFNKMDLVNKEDYKDIISMIEQAGYDIIFLNAKEERNMDIIKKLIKDNVTVFCGPSGVGKSTMLNKIIGKETMITGNISEKLKRGKHTTRHSELIYVDEGLLVDTPGFSSLDINFMEKEDLLYCIPEFRDFIGECKFTGCLHHREPNCAVKKAVEEGHIHKNRYDFYIKTLEEIMNRRKKKW

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

292 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

33.764 kDa

MKGTIIKGIGGFYYIKIDNSEEIIECKARGKFRHTELTPMIGDYVEISIDKNNKGAIEKIYERRSELFRPAVANVTQALVVFSFKNPDINIDLLNKFLLLCEYNNLKAIVCFNKMDLVNKEDYKDIISMIEQAGYDIIFLNAKEERNMDIIKKLIKDNVTVFCGPSGVGKSTMLNKIIGKETMITGNISEKLKRGKHTTRHSELIYVDEGLLVDTPGFSSLDINFMEKEDLLHCIPEFRDFIGECKFTGCLHHREPNCAVKKAVEEGHIHKDRYNFYIKTLEEFMNRRKKKW

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

292 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

33.764 kDa

MKGTIIKGIGGFYYIKIDNSEEIIECKARGKFRHTELTPMIGDYVEISIDKNNKGAIEKIYERRSELFRPAVANVTQALVVFSFKNPDINIDLLNKFLLLCEYNNLKAIVCFNKMDLVNKEDYKDIISMIEQAGYDIIFLNAKEERNMDIIKKLIKDNVTVFCGPSGVGKSTMLNKIIGKETMITGNISEKLKRGKHTTRHSELIYVDEGLLVDTPGFSSLDINFMEKEDLLHCIPEFRDFIGECKFTGCLHHREPNCAVKKAVEEGHIHKNRYDFYIKTLEEFMNRRKKKW

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

292 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

33.764 kDa

MKGTIIKGIGGFYYIKIDNSEEIIECKARGKFRHTELTPMIGDYVEISIDKNNKGAIEKIYERRSELFRPAVANVTQALVVFSFKNPDINIDLLNKFLLLCEYNNLKAIVCFNKMDLVNKEDYKDIISMIEQAGYDIIFLNAEKERNMDIIKKLIKDNVTVFCGPSGVGKSTMLNKIIGKETMITGNISEKLKRGKHTTRHSELIYVDEGLLVDTPGFSSLDINFMEKEDLLHCIPEFRDFIGECKFTGCLHHREPNCAVKKAVEEGHIHKNRYDFYIKTLEEFMNRRKKKW

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

292 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

33.764 kDa

MKGTIIKGIGGFYYIKIDNSEEIIECKARGKFRHTELTPMIGDYVEISIDKNNKGAIEKIYERRSELFRPAVANVTQALVVFSFKNPDINIDLLNKFLLLCEYNNLKAIVCFNKMDLVNKEDYKDIISMIEQAGYDIIFLNAEKERNMDIIKKLIKDNVTVFCGPSGVGKSTMLNKIIGKETMITGNISEKLKRGKHTTRHSELIYVDEGLLVDTPGFSSLDINFMEKEDLLHCIPEFRDFIGECKFTGCLHHREPNCAVKKAVEEGHIHKNRYDFYIKTLEEFMNRRKKKW

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

292 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

33.75 kDa

MKGTIIKGIGGFYYIKIDNSEEIIECKARGKFRHTELTPMIGDYVEISVDKNNKGAIEKIYERRSELFRPAVANVTQALVVFSFKNPDINIDLLNKFLLLCEYNNLKAIVCFNKMDLVNKEDYKDIISMIEQAGYDIIFLNAKEERNMDIIKKLIKDNVTVFCGPSGVGKSTMLNKIIGKETMITGNISEKLKRGKHTTRHSELIYVDEGLLVDTPGFSSLDINFMEKEDLLHCIPEFRDFIGECKFTGCLHHREPNCAVKKAVEEGHIHKNRYDFYIKTLEEFMNRRKKKW

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

292 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

32.829 kDa

MSKGKLIKGIAGFYYVEVNKEVYECKGRGILRKKKLTPLVGDYVEITVTDEDNKKGMIDDIFPRKTELIRPTVANVDQVIVVFSVTQPDPHLSLLDHFLILAETQNIDVVICLNKLDLVQREDVAELVGIYEKVGYPVILTSQNDSIGLEQLEKVLRGKTTVFAGPSGVGKSTLLNRILPHVTLQTGELSSKIARGKHTTRHVELISLETEGWVVDTPGFSSLNIDFLKEEELADYFIDFEPFAKDCRFLSCVHLNEPICGVKTALKAGQLVQSRYNSYLQMIGEIKKNRRY

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

292 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

32.993 kDa

MQGQIIKALAGFYYVESDGQVYQTRARGNFRKKGHTPYVGDWVDFSAEENSEGYILKIHERKNSLVRPPIVNIDQAVVIMSVKEPDFNSNLLDRFLVLLEHKGIHPIVYISKMDLLEDRGELDFYQQTYGDIGYDFVTSKEELLSLLTGKVTVFMGQTGVGKSTLLNKIAPDLNLETGEISDSLGRGRHTTRAVSFYNLNGGKIADTPGFSSLDYEVSRAEDLNQAFPEIATVSRDCKFRTCTHTHEPSCAVKPAVEEGVIATFRFDNYLQFLSEIENRRETYKKVSKKIPK

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

292 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

32.993 kDa

MQGQIIKALAGFYYVESDGQVYQTRARGNFRKKGHTPYVGDWVDFSAEENSEGYILKIHERKNSLVRPPIVNIDQAVVIMSVKEPDFNSNLLDRFLVLLEHKGIHPIVYISKMDLLEDRGELDFYQQTYGDIGYDFVTSKEELLSLLTGKVTVFMGQTGVGKSTLLNKIAPDLNLETGEISDSLGRGRHTTRAVSFYNLNGGKIADTPGFSSLDYEVSRAEDLNQAFPEIATVSRDCKFRTCTHTHEPSCAVKPAVEEGVIATFRFDNYLQFLSEIENRRETYKKVSKKIPK

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

291 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

33.89 kDa

MKTGRIVKSISGVYQVDVNGERFNTKPRGLFRKKKFSPVVGDIVEFEVQNINEGYIHQVFERENELKRPPVSNIDTLVIVMSAVEPNFSTQLLDRFLVIAHSYQLNARILVTKKDKTPIEKQFEINELLKIYENIGYETEFIGNDDDRKKIVEAWPAGLIVLSGQSGVGKSTFLNHYRPELNLETNDISKSLNRGKHTTRHVELFERQNGYIADTPGFSALDFDHIDKDEIKDYFLELNRYGETCKFRNCNHIKEPNCNVKHQLEIGNIAQFRYDHYLQLFNEISNRKVRY

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

291 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

33.875 kDa

MKTGRIVKSISGVYQVDVNGERFNTKPRGLFRKKKFSPVVGDIVEFEVQNINEGYIHQVFERKNELKRPPVSNIDTLVIVMSAVEPNFSTQLLDRFLVIAHSYQLNARVLVTKKDKTPIEKQFEINELLKIYENIGYETEFIGNDDDRKKIVEAWPAGLIVLSGQSGVGKSTFLNHYRPELNLETNDISKSLNRGKHTTRHVELFERQNGYIADTPGFSALDFDHIDKDEIKDYFLELNRYGETCKFRNCNHIKEPNCNVKHQLEIGNIAQFRYDHYLQLFNEISNRKVRY

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

291 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

33.875 kDa

MKTGRIVKSISGVYQVDVNGERFNTKPRGLFRKKKFSPVVGDIVEFEVQNINEGYIHQVFERKNELKRPPVSNIDTLVIVMSAVEPNFSTQLLDRFLVIAHSYQLNARVLVTKKDKTPIEKQFEINELLKIYENIGYETEFIGNDDDRKKIVEAWPAGLIVLSGQSGVGKSTFLNHYRPELNLETNDISKSLNRGKHTTRHVELFERQNGYIADTPGFSALDFDHIDKDEIKDYFLELNRYGETCKFRNCNHIKEPNCNVKHQLEIGNIAQFRYDHYLQLFNEISNRKVRY

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

291 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

33.881 kDa

MKTGRIVKSISGVYQVDVNGERFNTKPRGLFRKKKFSPVVGDIVEFDVQNINEGYIHQVYERKNELKRPPVSNIDTLVIVMSAVEPNFSTQLLDRFLVIAHSYQLNARILVTKKDKTPIEKQFEINELLKIYENIGYETEFIGNDDDRKKIVEAWSAGLIVLSGQSGVGKSTFLNHYRPELNLETNDISKSLNRGKHTTRHVELFERQNGYIADTPGFSALDFDHIDKDEIKDYFLELNRYGETCKFRNCNHIKEPNCNVKHQLEIGNIAQFRYDHYLQLFNEISNRKVRY

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

291 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

33.875 kDa

MKTGRIVKSISGVYQVDVNGERFNTKPRGLFRKKKFSPVVGDIVEFEVQNINEGYIHQVFERKNELKRPPVSNIDTLVIVMSAVEPNFSTQLLDRFLVIAHSYQLNARVLVTKKDKTPIEKQFEINELLKIYENIGYETEFIGNDDDRKKIVEAWPAGLIVLSGQSGVGKSTFLNHYRPELNLETNDISKSLNRGKHTTRHVELFERQNGYIADTPGFSALDFDHIDKDEIKDYFLELNRYGETCKFRNCNHIKEPNCNVKHQLEIGNIAQFRYDHYLQLFNEISNRKVRY

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

291 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

33.875 kDa

MKTGRIVKSISGVYQVDVNGERFNTKPRGLFRKKKFSPVVGDIVEFEVQNINEGYIHQVFERKNELKRPPVSNIDTLVIVMSAVEPNFSTQLLDRFLVIAHSYQLNARVLVTKKDKTPIEKQFEINELLKIYENIGYETEFIGNDDDRKKIVEAWPAGLIVLSGQSGVGKSTFLNHYRPELNLETNDISKSLNRGKHTTRHVELFERQNGYIADTPGFSALDFDHIDKDEIKDYFLELNRYGETCKFRNCNHIKEPNCNVKHQLEIGNIAQFRYDHYLQLFNEISNRKVRY

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

291 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

33.302 kDa

MRTGRIIKSLSGVYRVDSDGEMFDTKPRGLFRKKKFSPIVGDIVDFEIENVTEGYIQHVHERQNELKRPPVSNIDHLVIVMSAVEPDFSTQLVDRFLVIAHSYGLNPRIVVTKKDMASDSQIERIEKDLDVYRAIGYPVQFVGKNDNIETIFDEWGSGLAVLSGQSGVGKSTLLNAYRPDLAIETNQISKSLNRGKHTTRHVELFERKGGFVADTPGFSALDFDHIHKDEVKDYFLEIQEYGQGCKFRNCNHIKEPQCNVKAQVEAGNIAQFRYDHYVQLFEEIANRKERY

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

291 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

33.714 kDa

MKTGRIVKLISGVYQVDVEGERFDTKPRGLFRKKKFSPVVGDIVDFEVQNTKEGYIHHVHDRNNELKRPPVSNIDELVIVMSAVEPEFSTQLLDRYLVIAHSYHLKPRILITKHDIASEQEILKIKDTIKLYQKIGYATQFIGKDSNYTATVDEWSDGLIVLSGQSGVGKSTFLNSYQPQLKLETNDISKSLNRGKHTTRHVELYDRKGGYIADTPGFSALDFNHIEKEQLKDFFIDIHEAGEQCKFRNCNHIKEPQCHVKTLVEKGEIPQFRYDHYQQLYNEISNRKVRY

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

291 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

33.684 kDa

MKTGRIVKLISGVYQVDVEGERFDTKPRGLFRKKKFSPVVGDIVDFEVQNTKEGYIHHVHDRNNELKRPPVSNIDELVIVMSAVEPEFSTQLLDRYLVIAHSYHLKPRILITKHDLASEQEILKIKDTIKIYQKIGYATQFIGKDSNYTATVDEWSDGLIVLSGQSGVGKSTFLNSYQPQLKLETNDISKSLNRGKHTTRHVELYDRKGGYIADTPGFSALDFNHIEKEQLKDFFIDIHEAGEQCKFRNCNHIKEPQCHVKALVEKGEIPQFRYDHYQQLYNEISNRKVRY

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

291 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

33.643 kDa

METGRIIKLISGVYQVDVDGTLYDTKPRGLFRKKKFSPIVGDIVDFEIQNTSEGYIHHVHERHNELKRPPVSNIDGLIIVMSAVEPDFSTQLLDRFLVIAHSYDLEPSILVTKKDLASENEIEQINAWLKIYEEIGYNTQFVGKHTSQQEVVATWPKGLIVLSGQSGVGKSTFINAFKPELNLETNHISKSLNRGKHTTRHVELFERESGFIADTPGFSALDFGHIDKDELKHYFIEMNRFGEECKFRNCNHIKEPKCHVKQQLENGYLAQFRYDHYIQLYNEISNRKVRY

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

291 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

33.871 kDa

MKTGRIIKSISGVYRVDVDGEMYDTKPRGLFRKNKFSPIVGDVVDFEVENVTEGYIHHVHERKNEIKRPPVSNVDHLIIVMSAVEPDFSTQLLDRFLVIAHSYHMRPRILVTKKDLTSLEKQHDIEKLLEVYENMSYKTQFISINEDIEQVFSSWGDGLAVLSGQSGVGKSTLLNKYFPNIEIETQHISKALNRGRHTTRHVELFERAKGFIADTPGFSALDYDHIQKDEIKNYFMEIHEYGATCKFRDCNHINEPKCNVKAELENGNIAQFRYDHYLQLFKEISNRKERY

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

290 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

32.929 kDa

MEGLVVKNYAGFYYVDTGKAIYMCKARGKFKKDNIKILTGDRVIIRELVPNSEGVIESLLPRKNELIRPPIANVDQVLLVFAFADPFPSTELIDRLLVMAYALRLEVVLVFNKFDLVNPESQKLFEYYKKILPKVVAITARGDTGIDELTDYLNQKISVLAGPSGVGKSTLINRLVPGAKLATGEVSPKIKRGRHTTRHVELIKLPFGGFIADTPGFSNLTLPEMDKLELQSYFPEFNQNRKYCYFPNCLHVKEPNCRVRELLETGEIPPFRYENYLTFLEEITSDERSS

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

290 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

33.308 kDa

MNGKIIKGIGGFYYIKTDQGLIECKARGKFRHKDIKPMVGDDVTIKMEHGKGVIEEIHERKSELVRPTVANVSLAFVVFAVKNPDINFDLLNKFLILCEYNNIEVIVCLNKIDLVSEEEREEIKKRINVIGYEVLFINAKKGIGIERLEEKIRGNITVFCGPSGAGKSTLINKLSNKEHMETGNVSVKLGRGKHTTRHSELIEVADGYIVDTPGFSTLEIKDLMDKNSLKYCFPEFTQYNDKCKYRGCLHYKEPNCALKEAVESEKINRYRYEFYVRALEEIIEEEKNKW

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

290 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

33.021 kDa

MKGKIIKGIAGFYYVKVEENLIECKARGKFRHKDVKPMVGDNVIIQVENGKGVIESIEKRSSELLRPAVANISLAFVVFAIKSPDINFDLLNKFLVLCEYNHIEAIVCLNKVDLVSEEERENVKKRINDIGYEVLYINAKEGLGTDILKEKINGNITVLCGPSGAGKSTLINKLTDKEHMLTGIVSEKIGRGKHTTRHSELIEVSNGYIVDTPGFSTLEIKELMEKEELKYCFPEFEEHNESCKYRGCLHNKEPKCAIKQDVEDGKINKYRYEFYVKTLEEIIEGEKNKW

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

290 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

32.977 kDa

MKGKIIKGIAGFYYVKVEENLIECKARGKFRHKDVKPMVGDNVVIQVENGKGVIESIEKRSSELLRPAVANISLAFVVFAIKSPDINFDLLNKFLVLCEYNHIEAIVCLNKVDLVSEEERENVKKRINDIGYEVLYINAKEGLGTDILKEKINGNITVLCGPSGAGKSTLINKLTNKEHMLTGIVSEKIGRGKHTTRHSELIEVSNGYIVDTPGFSTLEIKELMNKEDLKYCFPEFEEHNESCKYRGCLHNKEPKCTVKQAVEEGKINKYRYEFYIKTLEEIIEGEKNKW

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

290 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

32.3 kDa

MEGTLLRRYGGFYYVESEGRVWTCRLRGRFRLQETVFLPGDRVEIKPVGPGEGVIEDLKPRRTCLKRPAVANVEQVIIVFALREPPPDLELLDRLLFLSGVEDIEAVIVWNKADISKQEYAGLPELYRQIGYRNLITSAHTGQGIDELKALLAGRLSTFAGPSGVGKSSLLNAIQPGLNLRTGEVSSKGGRGRHTTRQAELIRLPDGGWVADTPGFSRLDLPAITREEVAAYFPEMEPLRGRCRYASCLHRKEPGCAVVAAVEAGLIIKHRYEHYLTFLAEVIARERSFS

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

290 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

33.422 kDa

MQGRIVKSLAGFYYVESDGVVYQTRARGNFRKKGQIPYVGDWVEFSSQDQSEGYILSIEERKNSLVRPPIVNIDQAVVIMSAKEPDFNANLLDRFLVLLEYKMIQPIIYISKLDLLDDLVVIDDIREHYQNIGYVFCYSQEELLPLLADKVTVFMGQTGVGKSTLLNKIAPELKLETGEISDSLGRGRHTTRAVSFYNVHKGKIADTPGFSSLDYEVDNAEDLNESFPELRRLSHFCKFRSCTHTHEPKCAVKEALTQGQLWQVRYDNYLQFLSEIENRRETYKKVIKRK

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

290 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

33.336 kDa

MQGRIVKSLAGFYYVESDGVVYQTRARGNFRKKGQIPYVGDWVEFSSQDQSEGYILSIEERKNSLVRPPIVNIDQAVVIMSAKEPDFNANLLDRFLVLLEYKMIQPIIYISKLDLLDDLVVIDDIREHYQNIGYVFCYSQEELLPLLANKVTVFMGQTGVGKSTLLNKIAPELKLETGEISGSLGRGRHTTRAVSFYNVHKGKIADTPGFSSLDYEVDNAEDLNESFPELRRLSHFCKFRSCTHTHEPKCAVKEALTQGQLWQVRYDNYLQFLSEIESRRETYKKVIKRK

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

290 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

33.253 kDa

MQGKIIESLAGFYYVESDGQIYQTRARGNFRKKGHKPYVGDEVDFSAKENSEGYILAIHERKNSLVRPPIVNIDQAVVIISAKEPDFNHNLLDRFLILLEHRKISPIIYLSKTDLLEDLDEFKKVQKQYQKIGYYFVYYLEDLTPLLKDKITVFMGQTGVGKTTLLNTLAPDLALETNEISDSLGRGRHTTRAVTLYNIYGGKIADTPGFSSLDYEITSSEELNAAFPELLKLSAACKFRSCTHTHEPGCAVKLALAQRKIWEKRYQTYLQILSEIENRRETYKKVLKRK

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

290 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

32.864 kDa

MQGKIIKSLAGFYYVESEGQVYQTRARGNFRKRGETPYVGDIVDFSAEDNSEGYILAIHPRKNSLVRPPIVNIDQAVVIMSAKEPEFNSNLLDRFLILLEHKAIHPVVYISKMDLLDSPEEIKAIGRQYQAIGYDFVTSLEELLPLLADKITVFMGQTGVGKSTLLNRIAPELALEIGEISDSLGRGRHTTRAVSFYNTHGGKIADTPGFSSLDYDIANAEDLNEAFPELRRLSHECKFRSCTHTHEPKCAVKAALETGELWPVRYEHYLQFLSEIENRRETYKKVIKRK

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

290 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

33.376 kDa

MEGIILKGIGGFYYVKTEERVYECKARGKFRNKKLTPMVGDRVIITPNDNNYGAIEEICTRDNYLIRPQVANISQAFIVFALKNPDVNLDLLNKFLIQCELKNIKSIVCFNKIDLYGDYENHEAVKMVSDAGYDYIFLKAKEETNLDELKSKLKGNINVFCGPSGVGKSTILNKLVGKEVMETGIISERLKRGKHTTRHSELVEVNNGFVVDTPGFSTLDLKFDSKEELKDYFREFYEYKDQCKFNGCLHHKEPKCGVKDAVNNEEINKDRYEFYVKTLEEIIQGGRNKW

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

290 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

32.978 kDa

MQGIITKGIGGFYYIKTEDGLYECKARGKFRLDELTPMVGDKVEIEIDNNSKGTIEKIFERKNKLIRPAVSNISQAIIVFAFKNPNINLDLLNKFLLQCEYNEINAVVAFNKVDLVENPEKEEVVDIIKSAGYEVIYLNAKEGMGIEKIREKLKGNLNVLCGPSGAGKSTIINKLVGKDVMETGQISEKLKRGKHTTRHSELIEVEDGFLVDTPGFSSLSIEDIEKEEIQFLFPEFIKYINGCKFTGCLHYKEPSCVVKNALEQGKIHKKRYEFYIQIIEEKLRGKNNKW

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

290 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

32.878 kDa

MQGKIIKSLAGFYYVESEGQVYQTRARGNFRKRGETPYVGDIVDFSAEDNSEGYILAIYPRKNSLVRPPIVNIDQAVVIMSAKEPEFNSNLLDRFLILLEHKAIHPVVYISKMDLLDSPEEIKAIGRQYQAIGYDFVTSLEELLPLLADKITVFMGQTGVGKSTLLNRIAPELALETGEISDSLGRGRHTTRAVSFYNTHGGKIADTPGFSSLDYDIANAEDLNEAFPELRRLSHECKFRSCTHTHEPKCAVKAALETGELWPVRYEHYLQFLSEIENRRETYKKVIKRK

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

290 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

32.85 kDa

MQGKIIKSLAGFYYVESEGQVYQTRARGNFRKRGETPYVGDIVDFSAEDNSEGYILAIHPRKNSLVRPPIVNIDQAVVIMSAKEPEFNSNLLDRFLILLEHKAIHPVVYISKMDLLDSPEEIKAIGRQYQAIGYNFVTSLEELLPLLADKITVFMGQTGVGKSTLLNRIAPELALETGEISDSLGRGRHTTRAVSFYNTHGGKIADTPGFSSLDYDIANAEDLNEAFPELRRLSHKCKFRSCTHTHEPKCAVKAALETGELWPVRYEHYLQFLSEIENRRETYKKVIKRK

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

290 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

32.85 kDa

MQGKIIKSLAGFYYVESEGQVYQTRARGNFRKRGETPYVGDIVDFSAEDNSEGYILAIHPRKNSLVRPPIVNIDQAVVIMSAKEPEFNSNLLDRFLILLEHKAIHPVVYISKMDLLDSPEEIKAIGRQYQAIGYNFVTSLEELLPLLADKITVFMGQTGVGKSTLLNRIAPELALETGEISDSLGRGRHTTRAVSFYNTHGGKIADTPGFSSLDYDIANAEDLNEAFPELRRLSHKCKFRSCTHTHEPKCAVKAALETGELWPVRYEHYLQFLSEIENRRETYKKVIKRK

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

290 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

32.878 kDa

MQGKIIKSLAGFYYVESEGQVYQTRARGNFRKRGETPYVGDIVDFSAEDNSEGYILAIYPRKNSLVRPPIVNIDQAVVIMSAKEPEFNSNLLDRFLILLEHKAIHPVVYISKMDLLDSPEEIKAIGRQYQAIGYDFVTSLEELLPLLADKITVFMGQTGVGKSTLLNRIAPELALETGEISDSLGRGRHTTRAVSFYNTHGGKIADTPGFSSLDYDIANAEDLNEAFPELRRLSHECKFRSCTHTHEPKCAVKAALETGELWPVRYEHYLQFLSEIENRRETYKKVIKRK

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

288 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

32.378 kDa

MQGIIIKGIAGFYYVKVEEEIYECKARGKFRLGELSPIVGDKVDITVINGKGVIEKIHPRTNKLIRPPVSNVTQAFIVFSIVNPEFSSDLLNKFLILCEFNNIKVKVCINKIDLVNEELLTPIKNLLNNTGYELKFLNAKSKIGINELKESLKDNITVVCGPSGVGKSTLMNSIAGSNVMKTGDISEKLKRGKNTTRHSELIEVAGGFIVDTPGFSSLDLNFIDRYELKDLFPEFYEYNGSCKYSTCVHDKEPGCEVKKAVEEGNINIERYNFYVDTLNKLSVRRNYK

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

287 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

33.342 kDa

MNAKILFKIANSFLLYDLSTKSQFNAVIRKKLKQEDRIITVGDNVEFVKDQYEYVIEKIDERKNLLIRPKVANIDTLIIVNSVKEPDFSSYGLNKFLAFYEARNINNVIIYFSKMDLLNKQESKNMNQIISQYEQNGYIVLNSLDKEKNKEKILNMIKNNVVCFAGQSGVGKSTLINFLIPDLELRTQEISQALNRGKHTTTSSLMIPFNEGFVIDTPGFGSLDLNMTQLELANSFTDFRNNSVHCKFKNCLHTNEQNCFIKKMVDENKIYKQRYLDYLKMFSEIKK

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

287 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

32.75 kDa

MRGTIMKGIGGFYYVNTDRGIIECRARGKFRYNGLFPMVGDKVEIKLERDQGIIDEICPRISQLKRPAVANVTQALVVFAFNHPEINEDLLNKFLISCEFNNLKPIVCFNKLDLADKEKKLDVIDMIRNTGYEVIFLKAKEGYGIDKVREKLKDNITVLCGPSGVGKSTILNAIYGKELMETGQISHKLNRGKHTTRHSEIIELEDGFMVDTPGFSSLDIGHITKDKLQYCFPEFIEFIGICKFTGCVHHKEPDCAVKSALYDDKINKRRYDFYVKTLNEISSKKKY

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

287 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

32.75 kDa

MRGTIMKGIGGFYYVNTDRGIIECRARGKFRYNGLFPMVGDKVEIKLERDQGIIDEICPRISQLKRPAVANVTQALVVFAFNHPEINEDLLNKFLISCEFNNLKPIVCFNKLDLADKEKKLDVIDMIRNTGYEVIFLKAKEGYGIDKVREKLKDNITVLCGPSGVGKSTILNAIYGKELMETGQISHKLNRGKHTTRHSEIIELEDGFMVDTPGFSSLDIGHITKDKLQYCFPEFIEFIGICKFTGCVHHKEPDCAVKSALYDDKINKRRYDFYVKTLNEISSKKKY

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

287 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

32.634 kDa

MEGIIIKGIGGFYYIKTDEGIIECKARGKFRYNSLKPMVGDRVTIKVENGKGVIEDIHERSSELIRPTVANVTQAFVVFAIKNPDINLDLLNRFLTLCEYNDIHAVVCLNKEDLCTEEEKENLKELINDIGYEVLFINAKEGKGFDALKERLEHNITVLCGPSGAGKSTLLNSFIDREHMETGSVSEKIGRGKHTTRHSELIDVDNGYLVDTPGFTTLDVTFIDRDSLKYCFPEFNDYNNLCKFNGCNHYKEPKCAVKEAVEEGKINKLRYDFYIKTLEEIINRRGN

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

287 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.

32.648 kDa

MEGIIIKGIGGFYYIKTDEGIIECKARGKFRYNSLKPMVGDRVTIKVENGKGVIEDIHERSSELIRPTVANVTQAFVVFAIKNPDINLDLLNRFLTLCEYNDIHAVVCLNKEDLCTEEEKENLKELINDIGYEVLFINAKEGKGFDALKERLEHNITVLCGPSGAGKSTLLNSFIDREHMETGSVSEKIGRGKHTTRHSELIDVDNGYLVDTPGFTTLDVTFIDRDSLKYCFPEFNDYNNLCKFNGCNHYKEPKCAVKEAVEEGKINKLRYEFYIKTLEEIINRRGN

rsgA

Small ribosomal subunit biogenesis GTPase RsgA

287 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.

Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.