About Products Protein Database Contact

Protein expression services for rsgA | Small ribosomal subunit biogenesis GTPase RsgA

Description
One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.
Family
Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.
Species
Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469)
Length
307 amino acids
Sequence
MKGIIYKSTGSWYLVKAEDGTYYNARLRGKFKHLDLKVTNPLSVGDFVDMNIDPLTPTEAMIFNIEPRTNYIIRRSSHKTAFGHLIACNIDQSILLVTLKQPKTSIGFIDRFLISCEAFRIPAVIVFNKSDLYNEALMEEYLYLKDVYEPLGYRCILTSMEKENGLDELMPLLQNKISVVSGHSGVGKSTLINKIFPQLDIKTDIISDHSQKGKHTTTFAEMYDLNETSKVIDTPGIKELGLFEIENDVLSHYFPEMRSLMGQCRFHNCKHTNEPGCRVKEYVEAFKIAPTRYESYCSIIFEKDTHR
Mass
35.2 kDa
Simulated SDS-PAGE
Western blot of rsgA recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make rsgA using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here