Description
One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play a role in the assembly of ribosomal proteins into the subunit. Circularly permuted GTPase that catalyzes slow GTP hydrolysis, GTPase activity is stimulated by the 30S ribosomal subunit.
Family
Belongs to the TRAFAC class YlqF/YawG GTPase family. RsgA subfamily.
Species
Clostridium botulinum (strain Kyoto / Type A2)
Sequence
MKGTIIKGIGGFYYIKIDNSEEIIECKARGKFRHTELTPMIGDYVEISIDKNNKGAIEKIYERRSELFRPAVANVTQALVVFSFKNPDINIDLLNKFLLLCEYNNLKAIVCFNKMDLVNKEDYKDIISMIEQAGYDIIFLNAKEERNMDIIKKLIKDNVTVFCGPSGVGKSTMLNKIIGKETMITGNISEKLKRGKHTTRHSELIYVDEGLLVDTPGFSSLDINFMEKEDLLHCIPEFRDFIGECKFTGCLHHREPNCAVKKAVEEGHIHKNRYDFYIKTLEEFMNRRKKKW
Simulated SDS-PAGE

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service