rimM

Ribosome maturation factor RimM

248 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

26.111 kDa

MSERDSGSSGRAKAAAAVAAATPRAKTSGPAPFGAFVRKPVEKAEGKAKAQVANAGSGAAEMRMETVESWPADAVEVGAIVDAYGLKGWVKVAAHADAGHGGDALLSAKRWWLIKGQERKSAPSLQAKMHSDSVVAHLGGVTDRDVALALRGSRVYISRSEFPALGADEFYWVDLLGLDVVNVAGVNLGKVADMIDNGAHSVLRIEYPDTDKSGKPVIGERLIPFVGVFVKTVDQAAKQITVDWEADY

rimM

Probable 16S rRNA-processing protein RimM

246 amino acids

Essential for efficient processing of 16S rRNA. Probably part of the 30S subunit prior to or during the final step in the processing of 16S free 30S ribosomal subunits. It could be some accessory protein needed for efficient assembly of the 30S subunit. It is needed in a step prior to RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes (By similarity).

Belongs to the RimM family.

26.921 kDa

MKRKQESKGAGEKRQGAGGRGQGEKKQGKQGRQGRQGRQGEKSPVPSPQSPIPNPQFTTPNPDEWLQIGKIVSAQGLSGEVRVYPDSDFPERFEVPGTRWLLRPGQTEPQPIELLHGRYLENKNLYVLQLAGVENRSQSEELRGCMLFVPASDRPELGEDEYHVVDLIGMEVFLQASGDLVGAVVDVIPAGNDLLEVSLHEPVTSDKKPKTVLIPFVKAIAPVVDLQTRRIEITPPPGLLELGSGV

rimM

Ribosome maturation factor RimM

244 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

25.73 kDa

MSERDSGSSGPVKAKAAAPRAKTSGQAPFGAFVRKPVEKTEGKAKANAANAGSGATEMRMETAESWPVDAVEVGAIVDAYGLKGWVKVAAHADAGHGGDALLSAKRWWLLKGQERKSAPSLQAKTHSDSVVAHLGGVTDRDVALALRGSRVYISRSEFPALGADEFYWVDLLGLDVVNVAGVSLGKVADMIDNGAHSVLRIEYPATDKSGKPVTGERLIPFVGVFVKTVDQAAKQITVDWEADY

rimM

Ribosome maturation factor RimM

235 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

25.773 kDa

MKHEEANKEIGGRGAEGQRSKRVGGNSKIQNIQSPAPNPQPIVPNTQSPVPNLDNWLEIGKIVSPQGLSGELKVYPVSDFPERFEVPGKRWLLHLDGTEPQPIQLLTGRYISNKNLYVIKLAGVENCDQAEALRGCKLMVPASDRPQLAEDEYHVLDLIGLEVFMQASGELVGTVVDIIPAGNDLLEVKLHPSFTTDKKQKTVLIPFVEAIAPVVDLKSNRIEITPPPGLLEINN

rimM

Probable 16S rRNA-processing protein RimM

233 amino acids

Essential for efficient processing of 16S rRNA. Probably part of the 30S subunit prior to or during the final step in the processing of 16S free 30S ribosomal subunits. It could be some accessory protein needed for efficient assembly of the 30S subunit. It is needed in a step prior to RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes (By similarity).

Belongs to the RimM family.

25.369 kDa

MKRKQDSKGAGSRGQGAGEKKQGAGGRGQGEKKQKKSPVPSPQSPVPDPDEWLQIGKIVSAQGLSGEVRVYPDSDFPERFEVPGTRWLLRPGQTEPQPIELLHGRYLENKNLYVLQLAGVENRTQSEELRGCMLFVPASDRPELGEDEYHVVDLIGMEVFLQTSGDLVGTVVDVIPAGNDLLEVSLHEPVPSDKKPKTVLIPFVKAIAPVVDLETRRIEITPPPGLLELGSGV

rimM

Ribosome maturation factor RimM

231 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

24.918 kDa

MSERDSGSSGRAKAKRQPGAKAPFGPFVRKPVEKVEANAAAAQKARAESAESWPDDAVEVGAIVDAYGLKGWVKVAAHADAGHGGDALLSTKRWWLEKGRERQSTPCLQSKVHGDSIVAQLGGTADRDAALALRGHRVYVRRRDFPALGTDEYYWVDLVGLDVVNEAGIELGKVADLIDNGAQSVLRIEYPAIGKDGKPVIGERLIPFVGVYVKTVDQAAKKIIVDWEADY

rimM

Ribosome maturation factor RimM

231 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

23.516 kDa

MARRPAGPTSRDGGRRGRTSSAIGKIAPDAATSPKAPAPRPAPPPVPPDPNLVLLGEFGRAHGLTGEVRLKSYTGDPQAIAGYGALQTSDGRTLALADVRPAPGSSPDMLIARVKGVSGRSAAEALNRVALFVPRDRLAAPEDDDEVYAADLIGAAAVDEAGTLVGTIVAVPNYGGGDLLELRPPNGGATALLPFTKAFVPVLDVAQRRVTVAAPEDLFAAPGEKPADDPG

rimM

Ribosome maturation factor RimM

230 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

24.561 kDa

MMAGHDSGNAKRGRSPSFGVFVRKPVERAPAKGASDGAVDSQAIRIDAAQSWPDDAVEVGAVVDAYGLKGWVKLAAHAGAGRGGDALLKARDWWLQKGAERKFARVTQAKLHGDTVVAHPDGSVDRDTALALRGARVFVRRGDFPALAADEFYWVDLIGLDVVNEAGVALGKIADMIDNGVHSIMRVEYPATGKDGRPKTGERLIPFVGVYVKAVEQAAGRVVVDWEADY

rimM

Ribosome maturation factor RimM

229 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

24.43 kDa

MAGHDSGNAKRGRSPSFGVFVRKPVERAPAKGASDGAVDSQAIRIDAAQSWPDDAVEVGAVVDAYGLKGWVKLAAHAGAGRGGDALLKARDWWLQKGAERKFARVTQAKLHGDTVVAHPDGSVDRDTALALRGARVFVRRGDFPALAADEFYWVDLIGLDVVNEAGVALGKIADMIDNGVHSIMRVEYPATGKDGRPKTGERLIPFVGVYVKAVEQAAGRVVVDWEADY

rimM

Ribosome maturation factor RimM

229 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

24.43 kDa

MAGHDSGNAKRGRSPSFGVFVRKPVERAPAKGASDGAVDSQAIRIDAAQSWPDDAVEVGAVVDAYGLKGWVKLAAHAGAGRGGDALLKARDWWLQKGAERKFARVTQAKLHGDTVVAHPDGSVDRDTALALRGARVFVRRGDFPALAADEFYWVDLIGLDVVNEAGVALGKIADMIDNGVHSIMRVEYPATGKDGRPKTGERLIPFVGVYVKAVEQAAGRVVVDWEADY

rimM

Ribosome maturation factor RimM

229 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

24.43 kDa

MAGHDSGNAKRGRSPSFGVFVRKPVERAPAKGASDGAVDSQAIRIDAAQSWPDDAVEVGAVVDAYGLKGWVKLAAHAGAGRGGDALLKARDWWLQKGAERKFARVTQAKLHGDTVVAHPDGSVDRDTALALRGARVFVRRGDFPALAADEFYWVDLIGLDVVNEAGVALGKIADMIDNGVHSIMRVEYPATGKDGRPKTGERLIPFVGVYVKAVEQAAGRVVVDWEADY

rimM

Ribosome maturation factor RimM

229 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

24.372 kDa

MAGHDSGNAKRGRSPSFGVFVRKPVERAPAKGASDGAVDSQAIRIDAAQSWPDDAVEVGAVVDAYGLKGWVKLAAHAGAGRGGDALLKARDWWLQKGAERKFARVTQAKLHGDTVVAHPGGSVDRDTALALRGARVFVRRGDFPALAADEFYWVDLIGLDVVNEAGVALGKIADMIDNGVHSIMRVEYPATGKDGRPKTGERLIPFVGVYVKAVEQAAGRVVVDWEADY

rimM

Ribosome maturation factor RimM

229 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

24.45 kDa

MAGHDSGNAKRGRSPSFGVFVRKPVERASAKGTSDGAVDSQAIRIDAAQSWPDDAVEVGAVVDAYGLKGWVKLAAHAGAGRGGDALLKARDWWLQKGAERKFARVTQAKLHGDTVVAHPDGSVDRDTALALRGARVFVRRGDFPALAADEFYWVDLIGLDVVNEAGVALGKIADMIDNGVHSIMRVEYPATGKDGRPKTGERLIPFVGVYVKAVEQAAGRVVVDWEADY

rimM

Ribosome maturation factor RimM

229 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

24.48 kDa

MAGHDSGNAKRGRSPSFGVFVRKPVERTSAKGTSDGAVDSQAIRIDAAQSWPDDAVEVGAVVDAYGLKGWVKLAAHAGAGRGGDALLKARDWWLQKGAERKFARVTQAKLHGDTVVAHPDGSVDRDTALALRGARVFVRRGDFPALAADEFYWVDLIGLDVVNEAGVALGKIADMIDNGVHSIMRVEYPATGKDGRPKTGERLIPFVGVYVKAVEQAAGRVVVDWEADY

rimM

Ribosome maturation factor RimM

229 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

24.45 kDa

MAGHDSGNAKRGRSPSFGVFVRKPVERASAKGTSDGAVDSQAIRIDAAQSWPDDAVEVGAVVDAYGLKGWVKLAAHAGAGRGGDALLKARDWWLQKGAERKFARVTQAKLHGDTVVAHPDGSVDRDTALALRGARVFVRRGDFPALAADEFYWVDLIGLDVVNEAGVALGKIADMIDNGVHSIMRVEYPATGKDGRPKTGERLIPFVGVYVKAVEQAAGRVVVDWEADY

rimM

Ribosome maturation factor RimM

229 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

24.405 kDa

MAGHDSGSAKRGRSPSFGVFVRKPVERAPTKGAGDGAADSEAIRIDAAQPWPDDAVEVGAVVDAYGLKGWVKLVAHAGAGRGGDALLKARDWWLQKGGERKFARVTQAKLHSDAVVAHPAGSVDRDTALALRGFRVFVRRGDFPALAADEFYWVDLIGLDVVNEAGVALGKVADMIDNGVHSIMRVEYPATGKDGRPTTGERLIPFVGVYVKAVEQAAGRIVVDWEADY

rimM

Ribosome maturation factor RimM

226 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

24.376 kDa

MSGHDSGNAKRGRASFGAFVRKPVERDVVASAGEAAEQGSLEAVQAWPDDAVEVGAVVDAYGLKGWIKVATHADAGRGGDALLDARRWWLERGGERLSARILQSKTHGDTVVAHAAGVSDRDAALALRGFRVFVRREDFPALAADEFYWVDLIGLEVVNEQSVALGTVSGMIDNGVHSIMRVEYPAVGKDGQPTTDERLIPFVGVYVKTVDQAARRIVVDWEADYS

rimM

Ribosome maturation factor RimM

225 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

24.347 kDa

MSGHDSGNAKRGRASFGAFVRKPVERDVVASAGEAAEQGSLEAVQAWPDDAVEVGAVVDAYGLKGWIKVATHADAGRGGDALLDARRWWLERGGERLSARILQSKTHGDTVVAHAAGVSDRDAALALRGFRVFVRREDFPELAADEFYWVDLIGLEVVNEQSVALGTVSGMIDNGVHSIMRVEYPAVGKDGQPTTDERLIPFVGVYVKTVDQAARRIVVDWEADY

rimM

Ribosome maturation factor RimM

225 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

24.475 kDa

MAGHDSGNARRGRASFGAFVRKPVERDSVANAGQAAEQGSPEATQAWPDDAVEVGAVVDAYGLKGWVKVATHADAGRGGDALLNARRWWLERGAERLSVRIMQSKTRSDTVVAQPAGVSDRDAALSMRGFRVFVRREDFPALAADEFYWVDLIGLEVVNEQSVALGKVSGMIDNGVHSIMRVEYPATGKDGQPTTDERLIPFVGVYVKTVDQAARRIVVDWEADY

rimM

Ribosome maturation factor RimM

225 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

24.425 kDa

MAGHDSGNARRGRASFGAFVRKPVERDSVANAGQAAEPGSPEATQAWPDDAVEVGAVVDAYGLKGWVKVATHADAGRGGDALLNARRWWLERGAERLSVRIMQSKTHSDTVVAQPAGVSDRDAALSMRGFRVFVRREDFPALAADEFYWVDLIGLEVVNEQSVALGKVSGMIDNGVHSIMRVEYPATGKDGQPTTDERLIPFVGVYVKTVDQAARRIVVDWEADY

rimM

Ribosome maturation factor RimM

225 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

24.456 kDa

MAGHDSGNARRGRASFGAFVRKPVERDSVANAGQAAEQGSPEATQAWPDDAVEVGAVVDAYGLKGWVKVATHADAGRGGDALLNARRWWLERGAERLSVRIMQSKTHSDTVVAQPAGVSDRDAALSMRGFRVFVRREDFPALAADEFYWVDLIGLEVVNEQSVALGKVSGMIDNGVHSIMRVEYPATGKDGQPTTDERLIPFVGVYVKTVDQAARRIVVDWEADY

rimM

Ribosome maturation factor RimM

225 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

24.453 kDa

MAGHDSGNARRGRASFGAFVRKPVERDAVANAGQAAEQGSLEEAQAWPDDAVEVGAVVDAYGLKGWVKVATHADAGRGGDALLKARHWWLERGAERLSVRIMQSKAHSDTVVAQPAGVSDRDAAFAMRGFRVFVRREDFPALAADEFYWVDLIGLDVVNEQSVALGKVSGMIDNGVHSIMRVEYPATGKDGQPTTDERLIPFVGVYVKTVDQAARRIVVDWEADY

rimM

Ribosome maturation factor RimM

225 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

24.206 kDa

MSGHDSGNARRGRASFGAFVRKPVERGAAASTGAAAEQGSLEAAQDWPDDAVEVGAVVDAYGLKGWIKVAAHADAGRGGDALLSARRWWLERGAERLSVRILQSKTHGDTVVAQPAGVDDRDAALAMRGFRVFVRREDFPALAADEFYWVDLIGLEVVNEQSVSLGKVSGMIDNGVHSILRVEYPTVGKDGAPATDERLIPFVGVYVKTVDQAARRIVVDWEADY

rimM

Ribosome maturation factor RimM

224 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

23.216 kDa

MARRPGSSSRGPARPDRLAPQAVTSARRPQTPDKSPKPASPDPSLVLLGEFGRPHGLHGEVRLKSFTGEPLAIAGYGPLHASDGRTLELEDARPAPGGSPDLLIVRVKGVDNRSGAEALNRITLAIARERLGQAEDEDEFFLTDLIGLAVEDPSGTVIGTIVAVPNYGGGDLLEIRPAAGGPTALLPFTKAFVPTLDLAGGKVVADPPEDLFAPPGPKPADDPG

rimM

Ribosome maturation factor RimM

223 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

23.873 kDa

MSDHDSGNARRGRASFGAFVRKPVERGAPAGAAAEQGGLDAVQALPDDAVEVGAVVDAYGLKGWVKVATHADAGRGGDALLSARRWWLEKGTQRFSARIVQSKTHGDTVVAQPAGVGDRDAALALRGFRVFVRREDFPALAADEFYWVDLIGLDVVNEQSATLGKVVGMIDNGAHSIMRVEYPSVGKDGRPAAAERLIPFVGVYVKTVDQAARRIVVDWEADY

rimM

Ribosome maturation factor RimM

223 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

22.896 kDa

MARRPGSSSRGPARSDRLPTEAVTSARKPHAAAPTPPASPDPGLVLLGEFGRPHGLHGEVRLKSHTSEPLAIAGYGPLHASDGRTLELANVRPAAGSSPDLLIVRVKGVDDRTGAEALNRVTLAIARERLGEVEDEDEFFLTDLIGLTVEDGAGTVIGTIVAVPNFGGGDLLEIRPAAGGPTALLPFTKAFVPSLDIAGGKVVADPPDDLFAPPGPKPADDPG

rimM

Ribosome maturation factor RimM

223 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

22.865 kDa

MARRPGSSSRGPARSDRLPAEAVTSARKPHAAAPTPPASPDPGLVLLGEFGRPHGLHGEVRLKSHTSEPLAIAGYGPLHASDGRTLELANVRPAAGSSPDLLIVRVKGVDDRTGAEALNRVTLAIARERLGKVEDEDEFFLTDLIGLTVEDGAGTVIGTIVAVPNFGGGDLLEIRPAAGGPTALLPFTKAFVPSLDIAGGKVVADPPDDLFAPPGPKPADDPG

rimM

Ribosome maturation factor RimM

222 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

24.103 kDa

MTERKQGAARPLNRPLVQPQGEPQKACKLPAALLYADPLPEDLVEVGYIGAAYGIRGWIKVLPHADDASALLHARRWWLLAPPQAGLVAADASRAQPVCVKIAQSREHSGTVVAQASGVADRNLAEALKGRRVWIRRADFPAPEEDEFYWVDLIGCTVSNEQGELLGEVSGLIDNGAHQILQVACVLPDGKAGERLIPFVDAFLRSVDTAGKRIVVDWGLDY

rimM

Ribosome maturation factor RimM

221 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

23.971 kDa

MTERKQGAAAPRPLNRPQGESPKATKLPATLLYADPLPDDLVEVGYVGAAYGIRGWIKVEPHANDASALLHARRWWLLTPPQAGLVATAEASRAQAVCVRVAQSREHSGTVVAQATGVSDRNLAEALKGRRVWIRRADFPAPEENEFYWVDLIGCAVSNEQGELLGEVSGLIDNGAHQILQVAYALPDGKAGERLVPFVDAFLRTVDTAGKRIVVDWGLDY

rimM

Ribosome maturation factor RimM

220 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

23.635 kDa

MTGNASGRKPLNLAATQGGASGRQKKLPAALLFTDTLPDDLVEVGYVGAAYGIRGWIKVQPHADDASALLHARRWWLLRAPPAGVVSAPAQSAEAVSIKISQSREHSGTVVAQPAGVSDRSVAEMLKGRRVWVRRADFPAAEEGEFYWVDLIGCAVVNEQGEALGEVTGLIDNGAHQILQVAYELPDGKAAERLIPFVDAFLRTVDTPARRIVVDWGLDY

rimM

Ribosome maturation factor RimM

218 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

22.386 kDa

MGEPVVVGRVGRPHGIRGDVTVDVRTDLPERRFAPGARLVRQVADGPASRPAADAAGAADAVGTAAGPGSAGDSGAARAAGPPVATVLSVVASRWHSGRLLVRFDGVTDRDAAEALRGSFLTIDSDECGPAVDPDDEDDDGELWWDRDLVGLHARTPAGDVLGEVVDVIHSPGGEILAIGRPEGGEYLVPFVREIVPTVDPAAGHIVVDPPPGLLDLD

rimM

Ribosome maturation factor RimM

217 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

23.551 kDa

MADHKLPRKEVAPRPDQTELRVGRLTKAHGLKGAIKLELFTDEPGKRFVPGAVFTLQVPTASKWHGKTLALRELRWYNGHPVGFFDGVDDRTEAESLVKAILWVNQDVRELPDEEDAWYDNQLVGLSAHRDGAVVGAIVRVDHLPGQDLLAIKTPGGEVLVPFVKAIVPEVDLAARTVTLTPPPGLFEDLPDDAPAAGDESEPVSPPVTAEETPGGE

rimM

Ribosome maturation factor RimM

213 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

23.572 kDa

MPTSPWVTLAHIVRPQGRRGEVIAELLTDFPEKFAERRHVFLTRDAASDAAPREMELAGYRLAQNRVVLHFAGIDSIDAAEMLRGLDVVIPESERAPLDQDAAYISDLIGCDVWDEAAGQRVGIVQDVDRQASHVDLLVVDCENGQRAEIPFVKAFLVKLDTTGKRITMRLPEGLLEINASTATAREPRARRTRKRGLRKPITGADATPPDSQ

rimM

Ribosome maturation factor RimM

212 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

22.668 kDa

METHMAKPKAPAGIENPVQLAVIGAAHGIKGEVRVKTFTEDPMALGSYGPLHMVDGRVLQVAAIRPAKEVVIVRFKGVDGRNAAEALNGEALFVDRSALPEKLEEEEFYYADLIGMAVLDEKGENLGRVVAVHNFGAGDLLEFRENSGPTVIIPFTRDAVPDIDLSNNTIRIDSITAGLDNAELSGEEDEAEGPESARGSRPRGPKSAGEPR

rimM

Ribosome maturation factor RimM

211 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

22.904 kDa

MWWTPIPEDIVRDPAAFRVGRLTKAHGLKGAVKLELFTDDPDKRFVPGAEFSLQVPESSPWHGRTLTLTELRWYNSHPVGFFDGVADRTAAESLAKAILWMTPPADEAAEPDAWYDHQLVGLTVLRDGVEVGTVSLVDHFPAQDLLHVDTPSGTVLVPFVQAIVPSVDVEAGTLVVTPPLGLFEEIPDETPTAEPTPAEAAEPAPEGDDAR

rimM

Ribosome maturation factor RimM

211 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

22.934 kDa

MWWTPIPEDIVRDPAAFRVGRLTKAHGLKGAVKLELFTDDPDKRFVPGAEFSLQVPDSSPWHGRTLTLTELRWYNSHPVGFFEGVADRTAAESLAKAILWMTPPADEPAEPDAWYDHQLVGLKVLRDGVEVGTVSLVDHFPAQDLLHVDTPSGTVLVPFVQAIVPSVDVEAGTLVITPPLGLFEEIPDEQPTPSATSDAEPGSAPEGDDAR

rimM

Ribosome maturation factor RimM

209 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

21.245 kDa

MARRPQRPAPSGRAGAGRGAAGAAPPGPDARLVVLGEFGRAHGLQGEVRLKSYTAEPMAIGGYGPLLASDGRVVELTALRPAAGTPDILVARVAGVAGRSAAEGLNRLTLSVPRDRLGAPEDEDEFFTADLVGLAAVDAAGTRLGTIRAVPNYGGGDLLEIEPEGGGRPALLPFTRLFVPKVEIAAGRVTIAPPEDLFAPPGPPPEGEG

rimM

Ribosome maturation factor RimM

209 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

23.833 kDa

MSSTSSTNTDDFITIARIQKTQGRVGEVFSELFTDFPELFEQRHHLYVLPEKGERRELELEDHWFHKGGVVLKFQGIETIDDAEKLLRSEVQIPRQDRAQLEEGATYVSDLVGCELFEIHGSEARKVGVVADVDFSAGEAPLLVVKGDREHLIPYVESFLKSTDFKAKRIEMVLPQGMLELDAPLSKAEKERQKSEADETREAGERRKR

rimM

Ribosome maturation factor RimM

208 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

23.153 kDa

MSEWIEIGKIVAPQGLKGDLRVYPSSDFPERFTEPGKRWLLSPGQVEPISIELLSGRYVPGKGLYVIELAGIKSRQQAEALRNSQLLIEKGDRPQLEADEFYVPDLIGLTVINQLNGKTIGKVINIIFAGNDLLEVEKISTDTPVISEVVENNLPSKSKRSRDTKNQKKNQSPPSKKILIPFVKEIVPIVNFEQSIIEITPPDGLIDL

rimM

Ribosome maturation factor RimM

207 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

22.358 kDa

MSEAAHSGAAPADLVELGRIASAYGVKGWVKVQPHSAQAEVLRTVSHWWLTRPAPQAARGVVASVPRAYQVLQARVHGGAVVAQLAGIDDRDQAEALRGCLVQAARSAFPAPADDEYYWVDLIGCALYSDADGESRLLGVVDEVFDNGAHAVLKVLRQQLQPGQPGPVPLVDPKGRPLEELVPFVRAHIRHVDLAARRIDSDWPLDY

rimM

Ribosome maturation factor RimM

207 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

22.358 kDa

MSEAAHSGAAPADLVELGRIASAYGVKGWVKVQPHSAQAEVLRTVSHWWLTRPAPQAARGVVASVPRAYQVLQARVHGGAVVAQLAGIDDRDQAEALRGCLVQAARSAFPAPADDEYYWVDLIGCALYSDADGESRLLGVVDEVFDNGAHAVLKVLRQQLQPGQPGPVPLVDPKGRPLEELVPFVRAHIRHVDLAARRIDSDWPLDY

rimM

Ribosome maturation factor RimM

207 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

22.474 kDa

MSEAAHSGAAPADLVELGRIASAYGVKGWVKVQPHSAQAEVLRTVSHWWLTRPAPQAARDVVASVPRAYQVLQARVHGGAVVAQLAGIDDRDQAEALRGCFVQAARSAFPAPADDEYYWVDLIGCALYSDADGEPRLLGVVDEVFDNGAHAVLKVLRQQIQPGQPGPVPLLDPKGRPLEELVPFVRAHIRHVDLAARRIDSDWPLDY

rimM

Ribosome maturation factor RimM

207 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

22.581 kDa

MNRPQGEPAKALRLPAALLYAEPLPEDLVEVGYVGAAYGIRGWIKVQPHADDASALLHARRWWLLSPPQAGLVAADAARSQPVCVKIAQSREHSGTVVAQAAGVADRNLAEALRGRRVWIRRADFPAPDEDEFYWVDLIGCNVSNEQGELLGEVSGLIDNGAHQILQVAFVQPDGKAGERLIPFVDAFLREVDTAGKRIVVDWGLDY

rimM

Ribosome maturation factor RimM

206 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

22.19 kDa

MPDAAHAAVPGDLVELGRINGAYGVKGWVKVQPHSAQADVLRKASSWWLTRLVPEKARGVVASAPQEYKVVQARPQGASVVAQLAGITDRDQAEALRGLAVQVSRSQFPAAADDEYYWVDLIGCAFYTNAEGEPARVGVVEEVFDNGAHAILRVVLQRAPAPGGEPEPRRDAKGRPLEMLVPFVGAHILAVDLSARRIDSNWPTEL

rimM

Ribosome maturation factor RimM

204 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.873 kDa

MQRDPAGAPRPAGASAAAPDLAGDPAFVLLGEFGRAHGLQGEVRLKSYTADPMAIGSYGPLTGANGRAIALTALRPASGAPDMLIARVSGVSGRDAAEALNRLALYVRRECLGAPEDEDEFFSADLIGLAVVDAAGTRLGTIRAVPNYGGGDLLEIEPTGGGAAALLPFTRAFVPKVDIAAREVTIDPPDDLFAPAKPSPEDEV

rimM

Ribosome maturation factor RimM

202 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

21.871 kDa

MRPGLQPSLGLTSSSLPDDALEVGRILDAWGVKGWVKILPHSTDPEALFSAKTWYLQTPDVKFRPGFSLFSGTVSLKVDEAKIHSGAVVAKFSGLDDRDAAEALRGARIFLSRSSFPAASADEYYWVDLIGLNVLNREGVALGCVRDLMATGPHSVLCVEYASTQEDGTSATAERMIPFVAAYVDKVDIAGKCITVDWQPDY

rimM

Ribosome maturation factor RimM

202 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

21.908 kDa

MGANSSSPAGLTPSSLPDDAIEVGRILDAWGVKGWVKILPHSTDPEALFSAKSWFLQAPEAKFRPGFNAFSGTVLLSVDEAKTHSDTVVAKFSGQDDRNAAEALRGARIFLPRSSFPVASKDEYYWVDLIGLNVVNREGVPLGQVRDLMTTGPHSVLCVEYTAQQEDGTAVTAERMIPFVSAYIDTVDIAGKCITVDWQPDY

rimM

Ribosome maturation factor RimM

202 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

22.248 kDa

MHDDPQQLELLRVARIGRAQGLKGEVTVRLYTDDPEWRFEPDSVLYSQDGETEYIVEGSRTFKDRWILKLEGVDDRNAAEALNGVELYGEVDDAEDMLEADEWYPKDLIGLEARLVEGNGLGLPAGQVVGKVVDVVDSPAQSLLKIRLTEPVVTGQNSKGEDVVEKTALVPFVEALVPDIDLEEQYLTLDPPGGLIPGCGMI

rimM

Ribosome maturation factor RimM

201 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

21.594 kDa

MTTRIVVAQILGAHGVHGRVKLKSFTADETAVFGYAPLTDESGRREFKLRRTGTGKDHFLAEVDGITGKEAADALRGTRLYIERDRLPAPEDEDEFYHADLIGLDTVTADDQPFGTIKAIYDFGAGDMLEIRHVSEKTVFLPFTKACVPVIEIAAGRVVVEPPANFFAPAGPQPAEGEEMPDGALEALEGEEAGAGTAPQP

rimM

Ribosome maturation factor RimM

201 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

21.166 kDa

MTERLLVGVIVGSHGVRGLVRVKSFTQDEMALCDYGPLSDETGTRRFAVEVRNQAKGVVICQIPGVSDRTAADALKGTRLFLDRAALPADALEEDEYYHADLIGLPVDLVDGGRLGVVHSVHDFGAGDMLEVTLAQGRRSVLLPFTKAVVPLVDVKAGRLVADPPLGLLDDTRPPAGVEGEVEEDPGVGIDEDGDGKGGAS

rimM

Ribosome maturation factor RimM

200 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

23.074 kDa

MIKEFRDLIDSMIPVGKVVKPHGLRGEVKMKSLTNQLKVFETLKKVLLYDEKAGTVVRAEIDTIRRAGKGYIVHFKGFKSVEAAERIRGFYVYAPLNVLPPLKEGEYYFYQLLDCEVYDPEGEYIGKVTDIIETGANDVIVVTKELPDFTVEEELIPVIKDYIVEFRFKDKKIVAKRLEYLTLEGKEDNDDENQRIDDIS

rimM

Ribosome maturation factor RimM

199 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

21.228 kDa

MMSKLICVARIGAAHGVRGEVRLWTFTEDPLAVLHYGPLTTKDGSRSFEVTKAREAKDHLVASFKGITDRNAAERLNGVELYVPRDRLPETDDDEYYHADLIGLAAETTAGAPLGRVLAIHNFGAGDIIEIAPPSGSTLMLPFTNAVVPTVDLAGGRVIIELPDEIDGEDRASADESASAEDDAAAPNSARHPRESGDP

rimM

Ribosome maturation factor RimM

199 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

21.871 kDa

MHGDPQQLELLRVARIGRAQGLKGEVTVRLYTDDPEWRFEPDSVLYSQDGETEYIVEGSRTFKDRWILKLEGVDDRNAAEALNGVELYGEADDAEDMLEADEWYPKDLIGLEARLVEGNGLGLPAGQVVGKVVDVVDSPAQSLLKIRLTEPVVTGQNSKGEDVVEKTALVPFVEALVPDIDLEEQYLTLDPPGGLIPGL

rimM

Ribosome maturation factor RimM

199 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

21.156 kDa

MSKPQNPVQMAVIGAAHGIKGELRVKTFTGEPMALADYGPLYARDGRAFQITDIRPANTVVVVRFKGISDRNAAEALAGTELFVDRSMLPDDGEEDEFYHADLVGLEVRDDTGTALGKVVAVHNFGGGDILDVTLAGRKGVLIPFTQAAVPDVSVAEGFVRVDPVAAGLVEDEDGDAPREEDFDPKGRPRGPRDAGGNR

rimM

Ribosome maturation factor RimM

198 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.933 kDa

MSKLICVAKIGAAHGVRGEVRLWTFTEDPLAVLHYGPLTTKDGSRSFEVAKAREAKDHLVATIKGVTDRNAAERLNGLELYVPRDRLPETDDDEYYHADLIGLAAETTAGAPLGRVLAIHNFGAGDIIEIAPPSGSTLMLPFTNAVVPTVDLAGGRVIIELPAEIEGEDQDSSDNAGSPEGDAAASNSARHPRESGDP

rimM

Ribosome maturation factor RimM

198 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

21.524 kDa

MPPPTASTPDDSADPGPDFADVPPTDLVKVGFIFRPHGLDGELKIDPSATDDPARFEVLPTVFVGPHPRRVVRHDIASVRYQKTKRGITVILGLDGIVDRDDAEAVAKMDVFATEAALGLEDDELFADDLVGWTVVTEEGAVQGTVADFMEMPAQDLFVVRTPEDTEAMIPAIDDFIIEIDEEAERIVVRPIDGLMDA

rimM

Ribosome maturation factor RimM

198 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

21.291 kDa

MQLVVARIGRAHGIKGEVTVEVRTDEPELRLGPGAVLATEPAATGPLTVEAGRVHSGRLLLRFEGVRDRTGAEALRNTLLIAEVDPDELPEEEDEFYDHQLIDLDVVLADGTGIGRITEISHLPSQDLFIVERPDGSEVMIPFVEEIVTEIDLEEQRAVITPPPGLIDESEAVVASSRDEETGEAASGDEAEAPKGDA

rimM

Ribosome maturation factor RimM

197 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

22.099 kDa

MKYSRKKLKNKVYLAIIDLPHGVKGDVLVKVWSAEPQRLKTYGILYDDTGRPYEIVVLRVQKNNAIVHFKGVEDRSAAEALKGIRLYVTRDQLVDDLAEDEFYQVDLIGLRVQDCAGQSLGKVSGFFNFGAGDLLEIRLNTRKTTVLIPFSKAAVPEICVTSGFLVVEPVAAGLLNNKEKNKVENDLDSNEDERMKK

rimM

Ribosome maturation factor RimM

197 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

21.21 kDa

MQLQVARIGKPHGIRGEVTVQVLTDAPEDRFIPGTRFVVEPASAGPLTVDSARWNKDILLLGFEGIETRNQAEALRGAKLFIETEELEEEDDEGWYEHELVGLDVRVGDAVVGTISGLRTLPVQDLIVVESPDGKEILIPFVEEIVPEVNVGEKYILVTPPPGLFEINVEDSGETSDAGESGPGEAEPGKAEAGDNA

rimM

Ribosome maturation factor RimM

196 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

21.185 kDa

MAERGQSSSAEGGASSQLVVVGRILGVHGVKGWVKVYSYTDPMVNLQQYQPWHLKQGALNSGGSSAAGTWKPVKVTGFRPQGKGLIAQLEGVSDREAAAALVGQDIGVPADLLPQSGQGEYYWRDLIGLRVKHVNGMDLGSVTRMVETGANDVVVVRGDRNSLDRRERLIPWLPEDVITAISLEDGEMTVDWDPDF

rimM

Ribosome maturation factor RimM

195 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

21.411 kDa

MHSDDPQQLELLRVCRIGRAQGLKGEVTVQIFTDEPEYRFAPGAVLYTKDGEEEYVVESSRTFKNRWIIKFEGIDDRDASEAANGVVLYGEADDPEEMLEADEWYPKDLISLEARLAEGNTLGLAPGTVVGKVVDVIEVAQWLLKIRLANPVKDADGVVVENSALVPFVDELVPDIDLEGGYLTLDPPGGLIPGL

rimM

Ribosome maturation factor RimM

194 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

21.172 kDa

MAAADESSWPADVVEVAKVIDAWGVKGWFRVHPYAADAQAVFTSRRWYLQGPDNRPRPKDAPALPRLLHVTEVKEHGDGIVACAPEVADRSAAEALKGARIFVSRASFPTVGDGEYYWIDLIGLSVVNRDGESLGTVTDLIDTGPHSVLRLGYPSVDDKGAPVEGERLIPFVAAYIDSVQLDQKRIVADWGLDY

rimM

Ribosome maturation factor RimM

194 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.957 kDa

MPDLQIGRVIKPHGVKGEVVVDPSTDHVPERFAIGEALRAVQTGKERQLTVTGMRRHQNRLLVTFEEIRDRDEAESLRGARFMAAPLHDDSDDGYYDHELIGLRVLNVGSVDADTANRRAYEGEQPEPVDIGEVTGVSHGPAGATLEVAVDADADLPTAGSTILIPFKLAIVPIVDLDNEALVVTPPEGLLELA

rimM

Ribosome maturation factor RimM

193 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.732 kDa

MAVSPDDPLILVGRVAGGFGVRGEVRITTYTEDPLSIAGFKALKRQDGSPALTIASARKTKDGVVCRCPGVETKEAADALRGLRLYVPRSALPEPDDDEFYLTDLVGLTVRHIQTDQLLGRVKSVQNFGAGDILEITPDLGGPTWYLPFTRAAVPEVRVSEGLILADPPALVGDHEGPEEKGLDENEELGDRD

rimM

Ribosome maturation factor RimM

193 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

21.213 kDa

MKEPMTKLENPVLMATIGGAQGLRGEVRAKAYTADPTALGDYGHLHSMDGRSFEILEIREMKNVVVVRFRGINDRNAAEALNGLELYIERDNLPDEELEDDEFYYADLEGLEARDDQGVSYGTVTGVFDFGAGDLLELKGPGKRPVLIPFSEASVLEIDLEAGTLLIDPLAAGLVDDPEELSKFTPDKPKKKK

rimM

Ribosome maturation factor RimM

193 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

21.279 kDa

MLDDEVVWPEDAIEVGRIVDAWGIKGGIKVLPFSSDPQALFSSRRWFLRPPEKPMGPKAAKPLPTLLRITNAREQGDVIVATAQDVADRNAAEALRGCSVFVSRASFPTADVDEYYWIDLIGLAVVNREGQALGNVADLLDTGAHSVLRVTQVETDDQGRSLERERLIPFVAAYIDAVSLEQRCITVDWGLDF

rimM

Ribosome maturation factor RimM

192 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

21.233 kDa

MHTMATALTLEPTALPSDAIEVGRIADAWGLQGWFKVQPYSADPEALFSCKRWYLQPAARGAKAFGGTVLLPIRQAKDHGGMVLAWAQDIDDRNTAEALRGARIFVPRSSFPSPPPGEYYWVDLIGLQVINRQGLALGQVRELRATGAQTLLVLAHEQDGKAGKRMIPFVPAFVDQVELPQKRIIVDWQPDY

rimM

Ribosome maturation factor RimM

192 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.619 kDa

MTQSSPQNLILVGRVAGAFGVRGELRIATYTEDPLTLTRFKALTRQDGSPALTVQTARVVKDGVVARCAGVDTKEAADALRGLRLYVPRAALPEPDEDEYYLADLIGLPVRHVATDELLGKIKSVQNFGADDLLEIDPALGGQTWYLPFTRAAVPEVKIADGVVLADPPALVGEPEGPESPAEDDDGERHYD

rimM

Ribosome maturation factor RimM

192 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

21.409 kDa

MEENWLEIGTIVAPQGLEGELRVLSVSDFPERFQKRGMRGIQGPQGGEIREITLLRGRELPGKNVYVIKLEGVENREQAEALRGYKLWANKLEKPRLKADEYHVSELVNLEVYHHLTGEKIGVVVDIFWAGNDILAVQLEANLASVKKKSPSSDSEARALVPFVKEIVPLVDLKAARIEIAPPPGLLEINLS

rimM

Ribosome maturation factor RimM

192 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.992 kDa

MPVSDSLSPDLPNDDTSEEWLEVGTIVGAHGLNGEVKVYPDSDFPERFTQPGLRWLVSPTEASTPEEIQLIRGRFVERKGIYVVKLANVNFRDQSEALKGTKLLVRSNDRPTLAEGEYYLSDLIGVTVVDHQTQAVVGSVVSLASAGNDLLEIQLDNTTKTILLPFVSALVPIVDIATKRIEITPPKGLIPE

rimM

Ribosome maturation factor RimM

191 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

21.219 kDa

MEHNKKELNKAVLLAVIRAAHGIRGDVVVNLLGAEPQRLKTYGVLYDDKGRLYEIVSMRVHKNNVIVRFKGVDDRSTAEALKGVQLYIERDQFADDLDTDEFYQIDLIGLRVYDNTNQLLGEVSGFFNFGAGDLLEVRLISHKTELIPFSKAAVPEICVASGFLVVDPVAAGLFSDPHSFNDLALNDLEKG

rimM

Ribosome maturation factor RimM

191 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

21.834 kDa

MENNKNQWLEIGTIVSARGLKGELKVLSSTDFPERFEIPGKRWLQPPHDPYPQAIELISGKSVAGKNIYIVRLEGIENRNQAETLRGYKLLIMDQELPELEEEEYHVSQLINVQVYHHKTGELLGTVIDLFTTGHDLLEIQLINNSEREAKKTKERKVLIPFVYEIVPVVDLENNRIEINPPKGLLSLGDS

rimM

Ribosome maturation factor RimM

191 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.99 kDa

MPALPILDPADLPADAVEVGRIADAWGVKGWFKVLPYSADPEALFSSKRWYLQPSEKGAKSFFTGTVLLPIRQAREHSDSVVAQAQGVDDRDAAEALRGARIFVPRSSFPTAAEDEYYWVDLIGLEVVNREGVALGSVRELLATGPQTTLVLSFPQEGGKEGERMIPFVSAFVDRVDIAGRRIVVDWQPDY

rimM

Ribosome maturation factor RimM

191 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.477 kDa

MSVRVARIGKPHGVRGEVTVELFTDDPQARFAPGSVLSIQHARGGRRGQGSAADAREPLAVQSLTVTGHRWNKDVLVARFEEISDRNAAEAARGLELFAEVADLPLEDDEWHQDDLLGLVAVDLTRGEARIGTVKALIQGSAQDLLEITPQGGGRTVLVPFVEEIVPEVDLDRGLVLVSPPPGLLELGEGE

rimM

Ribosome maturation factor RimM

190 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.728 kDa

MSERTLPDDLVELGRVASAYGVKGWIKVQPHSAQADVLRAAKQWWLAATPKSAPRVYAVQQCRVHGATAVAQLEGIADRDQAEALRGATVWVSRALFPAAAEDEYYWIDLVGCAFYSSVSGSDVRVGVVEEVFDNPAHAILRVVCQDAEGKALLDAKGRAREMLVPFVSAHIQAVDIAARRIDSDWPLED

rimM

Ribosome maturation factor RimM

190 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.43 kDa

MELVVGRVAKSHGIKGELVVEVRTDEPEDRFAVGSVLRGRKPRESTLKSYTVEAARDHSGRLLLRLEGVSDRGDADALRGTLFVIDSSELEPSDDPDEFYDHELEGLKVVLTDGTEVGSVIEVLHSAAGELLSIRRTGETSGELLIPFVAAIVTSVSIADGVVMIEPPEGLLDPDFGDKSNSDNSNSDND

rimM

Ribosome maturation factor RimM

190 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.869 kDa

MPQLPVLETAELPSDAVEVGRITDAWGVKGWFKVLPYSSNPEALLAAKSWLLQPAEKGAKSFFAGTVLLPIRQARTHSDSVVAWAQGVDDRDAAEALRGARIFVPRANFPVAGDDEYYWVDLIGLPVVNREGVALGTVRDLLPTGPQTTLVLAYEHEGKPHERMIPFVSAYVDKVDLAGRCITVDWQPDY

rimM

Ribosome maturation factor RimM

190 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.558 kDa

MTKLENPVLMATIGAAQGLRGEVRARAFTSDPTALGDYGHLHSMDGRIFEVLEIREAKNVVIVRFRGVNNRDAAEALNGLELYIERDNLPDDELEDDEFFYTDLEGLEAVDDKGTAYGTVSGVYDFGAGDLLELKGPGKRPVLIPFSEAAVLEIDLEGGKILIDPMAAGLIDSPDDLTGKPPKPPGKTKE

rimM

Ribosome maturation factor RimM

189 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.554 kDa

MPRPENPIQLAVIGAAHGTRGEVRVKTFTGDPLAIADYGLLYDEQGKAYEILEARVAKTVVIVRFKGVNDRNAAEALNGTELFIDRSQLPDEELDEDEFFQTDLIGLEAVDGDGKSYGVVSAIFDFGGGDLIELSEKGKRPMLIPFTEAAVPEIDFDKGIIKVEPHAAGLIADEHDNPPHESGKKPKKP

rimM

Ribosome maturation factor RimM

189 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.554 kDa

MPRPENPIQLAVIGAAHGTRGEVRVKTFTGDPLAIADYGLLYDEQGKAYEILEARVAKTVVIVRFKGVNDRNAAEALNGTELFIDRSQLPDEELDEDEFFQTDLIGLEAVDGDGKSYGVVSAIFDFGGGDLIELSEKGKRPMLIPFTEAAVPEIDFDKGIIKVEPHAAGLIADEHDNPPHESGKKPKKP

rimM

Ribosome maturation factor RimM

189 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.554 kDa

MPRPENPIQLAVIGAAHGTRGEVRVKTFTGDPLAIADYGLLYDEQGKAYEILEARVAKTVVIVRFKGVNDRNAAEALNGTELFIDRSQLPDEELDEDEFFQTDLIGLEAVDGDGKSYGVVSAIFDFGGGDLIELSEKGKRPMLIPFTEAAVPEIDFDKGIIKVEPHAAGLIADEHDNPPHESGKKPKKP

rimM

Ribosome maturation factor RimM

189 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.554 kDa

MPRPENPIQLAVIGAAHGTRGEVRVKTFTGDPLAIADYGLLYDEQGKAYEILEARVAKTVVIVRFKGVNDRNAAEALNGTELFIDRSQLPDEELDEDEFFQTDLIGLEAVDGDGKSYGVVSAIFDFGGGDLIELSEKGKRPMLIPFTEAAVPEIDFDKGIIKVEPHAAGLIADEHDNPPHESGKKPKKP

rimM

Ribosome maturation factor RimM

189 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.554 kDa

MPRPENPIQLAVIGAAHGTRGEVRVKTFTGDPLAIADYGLLYDEQGKAYEILEARVAKTVVIVRFKGVNDRNAAEALNGTELFIDRSQLPDEELDEDEFFQTDLIGLEAVDGDGKSYGVVSAIFDFGGGDLIELSEKGKRPMLIPFTEAAVPEIDFDKGIIKVEPHAAGLIADEHDNPPHESGKKPKKP

rimM

Ribosome maturation factor RimM

189 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.554 kDa

MPRPENPIQLAVIGAAHGTRGEVRVKTFTGDPLAIADYGLLYDEQGKAYEILEARVAKTVVIVRFKGVNDRNAAEALNGTELFIDRSQLPDEELDEDEFFQTDLIGLEAVDGDGKSYGVVSAIFDFGGGDLIELSEKGKRPMLIPFTEAAVPEIDFDKGIIKVEPHAAGLIADEHDNPPHESGKKPKKP

rimM

Ribosome maturation factor RimM

189 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.554 kDa

MPRPENPIQLAVIGAAHGTRGEVRVKTFTGDPLAIADYGLLYDEQGKAYEILEARVAKTVVIVRFKGVNDRNAAEALNGTELFIDRSQLPDEELDEDEFFQTDLIGLEAVDGDGKSYGVVSAIFDFGGGDLIELSEKGKRPMLIPFTEAAVPEIDFDKGIIKVEPHAAGLIADEHDNPPHESGKKPKKP

rimM

Ribosome maturation factor RimM

189 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.554 kDa

MPRPENPIQLAVIGAAHGTRGEVRVKTFTGDPLAIADYGLLYDEQGKAYEILEARVAKTVVIVRFKGVNDRNAAEALNGTELFIDRSQLPDEELDEDEFFQTDLIGLEAVDGDGKSYGVVSAIFDFGGGDLIELSEKGKRPMLIPFTEAAVPEIDFDKGIIKVEPHAAGLIADEHDNPPHESGKKPKKP

rimM

Ribosome maturation factor RimM

189 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.554 kDa

MPRPENPIQLAVIGAAHGTRGEVRVKTFTGDPLAIADYGLLYDEQGKAYEILEARVAKTVVIVRFKGVNDRNAAEALNGTELFIDRSQLPDEELDEDEFFQTDLIGLEAVDGDGKSYGVVSAIFDFGGGDLIELSEKGKRPMLIPFTEAAVPEIDFDKGIIKVEPHAAGLIADEHDNPPHESGKKPKKP

rimM

Ribosome maturation factor RimM

189 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.643 kDa

MAPSCPTRSRVWSSRTSPPPDLAESEAWVVMGRVSAPFGVKGWVKVQPFSEDPGTLMDFESWRVGRGEQQAQYAVEAVQDHGKSLVAKLVGIDDRDAAFALRGQEVSVAKSALPPPEENEFYWSDLIGLTVMNREGVELGKVDSLMESGAHDLLVVKGRREHLIPFVAAFVGKVDLAGGTVEVDWGEDY

rimM

Ribosome maturation factor RimM

189 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

21.949 kDa

MKHDEYSINKEDVMIPPLHPVVIGRIIGAYGILGWVRILSFTEKNDNIFYYSPYFIIVQSTWKEIFLDKWKLIGKRYIVKIRGVSNRNSAQSLSRCNIIIDETQFPCINDDEYYWKDLIGCVVITVQGVLLGDIISIIETTANDVLVVKMCQNNLYKIKNCLIPFLIKRVIKNINLVTRTVTVDWDPNF

rimM

Ribosome maturation factor RimM

189 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.887 kDa

MSHMPELEASVLPADAVEVGRIADAWGIKGWFKVAAFSADPEALFTAKQWYLQPPEKGARQFTGTVLLPVKQARVHSDSVVATSPVVNDRNTAEALRGARIFVARSDFPQPEDGEYYWVDLLGLSVVNREGVVLGVVRDLLSTGPQTVLVLAYEEDGKERERMIPFVDAYVDKVDLPGKTIVADWQPDY

rimM

Ribosome maturation factor RimM

189 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.676 kDa

MPRPENPIQLAVIGAAHGTRGEVRVKTFTGDPLAIAEYGLLYDEQGKSYEVLEARPAKTVVVVRFKGINDRNAAEALNGTELFIDRSQLPDDELDEDEFFQTDLIGLLAVDAEGKTYGVVSALFDFGGGDLIELSEKGKRPMLIPFTEAAVPEIDLDKGTLLVEPYAAGLIADDEDERPQNEKKKPKKS

rimM

Ribosome maturation factor RimM

189 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.655 kDa

MTKLENPVLMATIGGAQGLRGEVRAKAYTADPGALGDYGHLHSMDGRSFEVLEIREMKNVVVVRFRGVNDRNAAEALNGLELYIERDNLPDEELDEDEFYYADLEGLEARDDKGVSYGTVTGVFDFGAGDLLELKGPGKRPVLIPFSEASVLEIDLEAGTLLIDPLAAGLVDDPEELSKFTPDKPKKKK

rimM

Ribosome maturation factor RimM

189 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.615 kDa

MTKLENPVLMATIGGAQGLRGEVRAKAYTADPSALGDYGHLHSMDGRSFEVLEIRETKNVVIVRFRGVNDRNAAEALNGLELYIERDNLPDEELEDDEFYYADLEGLEARDDKGASYGTVTGVFDFGAGDLLELKGPGKRPVLIPFSEASVLEIDLEAGTLLIDPLAAGLVDDPEELSKFTADKPKKKK

rimM

Ribosome maturation factor RimM

189 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

21.925 kDa

MKNVLLPNNQERKRSLSNSEIFTFDDKRLLIGQINSLFGVQGWVKIFSHTHPRENILFYQPWHINVDANWQTLEIIQGCVQAKTIVAQIKDVFDKEQARAYIGIDLYIKKSQLPQLKSGEYYWDDLIGLEVINKAKIILGKVSNLVDTGSNNVLVINGEREHWVPYISPFLIKVDIDNQIILVDWDENF

rimM

Ribosome maturation factor RimM

188 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.116 kDa

MDRERILMGVVGRPHGVRGLVRVHSYAAVPEDLTAYGALTDEHGQVWSLRWRGDGIAELRDAAGQPLSGRDAAQAMVNRRLYVARTSLPEPDQDEFYFTDLIGMDVRAQGTDAPLGRVLVVHDYGAGVSLELGGQGHAPLILPFTRACFPVVDVAAGRIEAVLPDEIEVQGDLSDKGEVEVSATGGAS

rimM

Ribosome maturation factor RimM

188 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.464 kDa

MSTPSLDNLIELGAISEAQGLQGQVKVRPHSPDPVALLSSKVVWLSLLPRRSAGALSSTEEATLTQYKVKSAKMHSGNVVLTLDGVSDRDQALALKGARILLDRDAFPKAESDSYYWVDLIGCKAKNLQDEILGDVIDVTENGAHGVIAIGDISTKTIQYLVPFVKEVVRNVDLPNKLLTLDWQSDWV

rimM

Ribosome maturation factor RimM

188 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

19.686 kDa

MTRPEASGPPDATRLGHLLGPHGVQGGIKLYVLGDPAQVLALKRVYVESRGWLSLRRAEGMPPNLVLYLAGVSSREGAEELRGLQVYATDAELPDLEEGTFYYHDLRGLEVYGAGGERLGTVSDVMDAGHQDLLVVDYGGGTSFVPLQAPYVEVPLAGGKPGAVHLTADAPAGLIGPEPGEEDGAAES

rimM

Ribosome maturation factor RimM

188 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

19.779 kDa

MAPTPDRDGQDKKVCLGVVTGAHGVRGLVRVKPYTEMPEGVAAYGPVETKDGATSFAISLKGMAKDLVICKLEGVDDRDVAAALRGTELYVPRERLPRASGDEEGWYYADLIGLRAVGLDGRDYGRIAGVENFGAGDLLEIAPAEGGQTVLMGFTDENVPEVDIAGGRVVIDPPAGTFGDDAEAERGE

rimM

Ribosome maturation factor RimM

188 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.251 kDa

MQLVVARIGRAHGIKGEVTVEVRTDEPELRLGPGAVLATDPASTGPLTIESGRVHSGRLLLRFAGVHDRTGAEALRNTLLIADVDPDERPEDEDEYYDHQLIDLDVVTEDGTEVGRITEISHLPTQDLFVVERPDGSEVYVPFVSEIVTGIDLDAQRAVIDPPPGLIDDRAEIASARDAGAEDAGDEA

rimM

Ribosome maturation factor RimM

188 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.251 kDa

MQLVVARIGRAHGIKGEVTVEVRTDEPELRLGPGAVLATDPASTGPLTIESGRVHSGRLLLRFAGVHDRTGAEALRNTLLIADVDPDERPEDEDEYYDHQLIDLDVVTEDGTEVGRITEISHLPTQDLFVVERPDGSEVYVPFVSEIVTGIDLDAQRAVIDPPPGLIDDRAEIASARDAGAEDAGDEA

rimM

Ribosome maturation factor RimM

188 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.476 kDa

MTATSPYLELGYVARAHGLRGEVAIRALDPASETLDTVDRIWVRTRAGVEREMRLEALRPTPKEDIVVLEGVESRNDAEALVGAKVFVFREDLEPPAEGEFFQGDLVGLDAVDANGNALGRVEEIWTTGEVPNLVIRASGREELVVPFADEFVPTVDLEARRIVIHPPEYVEAGRKGAESGGGPEDAE

rimM

Ribosome maturation factor RimM

188 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.417 kDa

MTKLENPVLMATIGGAQGLRGEVRAKAYTADPTALGDYGLLHSTDGRSFEILEIREMKNVVVVRFRGINDRNAAEALNGLELYIERDNLPDEELEDDEFYYADLEGLEALDDKGVSYGTVTGVFDFGAGDLLELKGPGKRPVLIPFSEASVLEIDLEAGTLLIDPLAAGLVDDPELSQFTAGKPKKKK

rimM

Ribosome maturation factor RimM

188 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.341 kDa

MAKLENPILMAKIGGAQGLRGEVRVSTYTDDPMALGDYGNLVTADGRVFEILEVREGKNVVVVRFRGINDRNAAESLNGLELFIERDNLPDDELDDDEFYYADLEGLEAVDAEGKSYGAVSAVYDFGAGDLLELKGAGRRPALIPFSEAAVLEIDLEAGRILIDPMAAGLIDNPDDKDQNGMSPFGKK

rimM

Ribosome maturation factor RimM

187 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

19.879 kDa

MTSTPSPSTADPNSTNDWLPVGTLVGAQGLKGELRLNPASDFPERFTEPGTRWLQAKGSAPKEVELLEGRQLPGKSLYVVRLKGVNNRASAEALVGCTVLVPAKDRPELAEGEFHLLDLVGLEARLAGSDEPIGTVSNLISGGNDLLEIKLNSGKTVLVPFVEAIVPDVQLEEGWLLLTPPPGLLEL

rimM

Ribosome maturation factor RimM

187 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.366 kDa

MTQLKNPVLMATIGAAQGLRGEVRVKSFTDDPAALGDYGNLHSEDGRVFEVLEIREAKNVVVVRFRGINDRTAAEALNGLELFIERDNLPDDDLDEDEFFYADLEGLEAVDRTGKSYGSVTGVFDFGAGDLLELKGPGLRPVLIPFTEWSVLEIDLEAGKLVIDPTAAGLVDDEKSGPGKPFPTKRK

rimM

Ribosome maturation factor RimM

187 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.454 kDa

MLPGLEAAELPADAIEVGRIADAWGIKGWFKVLPYSADPEALFSARRWFLLPAEKGAKTFSGVAQLAIKEAKVHSDTVVASAQAVDDRTAAEALRGARIFVARSSFPSAEKDEYYWVDLIGLNVVNREGVAMGTVKELLSTGAQTVLVLEYSQDGKAQERMIPFVSVYIDEVDLPGHRILVDWQADF

rimM

Ribosome maturation factor RimM

187 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.401 kDa

MELQIGRVIKPHGVRGEVVVDPTTDTPELRFATGEVLKGKQAGKELSLTVRSFRPHQGRLLVTFEEIADRTAAESLRGVRFFAAPVHDEDDDGFYDHELEGLTAYLLAPGTDLKGDEIQLGDLVGEVVAVEHTPAGQLLVILIDAESQLPTAGKEVLVPFRHQIVPVVDLEEEILVLTPPEGLLELS

rimM

Ribosome maturation factor RimM

187 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.532 kDa

MTKLENPVLMATIGAAQGLRGEVRVKSFTDDPTALGDYGNLHSEDGRVFEVLEVRETKNVVIVRFRGINDRSAAEALNGLELFIERDNLPDDDLDEDEFFYADLEGLEAVDGTGKSYGSVTGVFDFGAGDLLELKGPGRRPVLIPFTEWSVLEIDLEAGKLLVDPVAAGLVEDKDESLDKQFPTKRK

rimM

Ribosome maturation factor RimM

187 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.4 kDa

MTQLKNPVLMATIGAAQGLRGEVRVKSFTDDPTALGDYGNLHSEDGRVFEVLEIREAKNVVVVRFRGVNDRTAAEALNGLELFIERDNLPDDDLDEDEFFYADLEGMEAVDRTGKSYGSVTGVFDFGAGDLLELKGPGLRPVLIPFTEWSVLEIDLEAGKLVIDPTAAGLVDDEKSGPGKPFPTKRK

rimM

Ribosome maturation factor RimM

187 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

19.131 kDa

MTNPDHTCVGAISGSFGVRGEVRLKSFCAEPSDIGSYGPLSTEDGAQTYTITLTRPVKAGYAAMLSGVATKEDADALRGTRLYAPRSALPSLPDDEFYHADLVGLTVLDTGGEVIGTVASVANHGAGDILELSGPGLPSGLLIPFTLAVVPTVDIAAGRVIVDMPDGLIGGDKPDTSDTAPLGQDFD

rimM

Ribosome maturation factor RimM

186 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

19.884 kDa

MSRDLILLGVIGRPHGVRGLVHVVSYTADPDDLTAYGLLHDEAGRQIMLDWRADGLAGITIDGVPVQDRSAAERLTNTRLFINRDALPPVEDEDDFYLVDLIGLEARLVADETLLGQVAQVHDYGAGASLEITRSGGASLLVPFTRAAVPVVDIAAGRVLIDPPQEENAPEFGRNELGHDDGGEAA

rimM

Ribosome maturation factor RimM

186 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.702 kDa

MVASRDTAWLLVGQVVAAHGLRGWLRVKCWSDFPERLTEPGPRWLQRDSDPEPLLHPLIEGQFFPAKGLYLVRLEGIPDRTAAEAWVGAKVLVPASQRLPLEPEEYHYSDLIGLAVYHQGRLLGHVSAIWAAGQDVLEIATPDKRQVLIPFVKALVPVVDLEKGELQVQPPPGLVESFLGQDRARN

rimM

Ribosome maturation factor RimM

186 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.88 kDa

MDNSESWLEIGRIVAAQGLKGELKVMSSSDFPERFEKPGTRWLQSPDRLSIQEVELVRGRYVPGKNLYVIKLAEIADRTQAETLRDYTLLVPSSDRPQLNEGEYHVSDLINLTVYHQQTGEEIGVVTDMLSAGNDLLEVQLNTLNSSENTSSKKVLIPFVYEIVPVVDLVNKRIEINPPVGLLELS

rimM

Ribosome maturation factor RimM

186 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.333 kDa

MQLVVARIGRAHGIKGEVTVEVRTDEPELRLGPGAVLATDPASVGPLTIETGRVHSGRLLLRFEGVRDRNGAEALRNTLLIAEVDPDEVPEDPDEYYDHQLMDLDVVTKDGTEVGRITEISHLPSQDLFVVERSDGSEVYIPFVEEIVVEIDLEEQRAVIDPPPGLIDDRAEVDSSDTEAATEADA

rimM

Ribosome maturation factor RimM

185 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

21.451 kDa

MNSLSNLLDNKISVAKIVNSHGVHGEVKIVPFTNVKDVITNLEEVLLYNTSTRNFFFSKVLQVKPLNKFFVLNLRGIKDMDEAKKMIGYEVFIDKKDLPSLNSEEYYWYEILDSEVYYEDGEYVGKVEEIIQTGANDVISIKNLEDDKEVLIPMTDHYIIELKKEDKSIIVKKIEWYENGTNQAD

rimM

Ribosome maturation factor RimM

185 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.908 kDa

MVTMSKQTCIELPVNPIVLGKLGSTYGIRGWLRVFSSTEHAEDIFAYQPWFIQRAGRWQHIELEAWKHHNQDMIIKIKGIDDLDAANSLTNCEIIVDSEQLPELDTGDYYWKDLIGCQVISTAGYNLGTVNDMMETGSNDVMVVKANLKDAFGVKERLIPFLDGQVIKKVDLATKTIEVDWDPGF

rimM

Ribosome maturation factor RimM

185 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.716 kDa

MAEPMTEQQKTENWLEIGTIVAAQGIQGEVRVLSASDFPARFLTKGQRWIRKTPQETPQPLTLKKGKQIPGKNLYILRFTEITDRNQAEALVNYQLLVPATDRLPLEPGEFHVTDLLGLIVYDHDNGDRLGIVTDFYSAGNDLLGITLDKNPDKEVLVPFVEAIVPTVELAEQRLEIKTIPGLLD

rimM

Ribosome maturation factor RimM

185 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

19.698 kDa

MTEPADDLVFIAAIAGAHGVRGECKVKSFAGNPADAFKYGAFLDIDGKTILTPKAARPVKDGFVVRFAEPLDRDKAQALKGTKLHVLRSALPELEEDEFYHSDLLGLKVQGLDGAPMGTLKAVHNFGSGDLLEITGTPDRNGSWMLPFTREFVPHVSIAEGVITIDPPEDVGSKAEEEGGGAPDD

rimM

Ribosome maturation factor RimM

185 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

21.922 kDa

MKVIVINSTPINPIVIGRIKGAYGILGWVKILSFTEKIEDIFVYNPWFIFFRSKWKVIKLEYWRLMNNKNYIVKFFNVSDRNHAMALSQHNLVVESIQFPKLYNKDEYYWKDIIGCKIMTINGKCLGRVISIIDTKAHDILVVRSEEYGFTKYVDCLIPFILKKIIKDVDLIKNIVVVDWEIYKF

rimM

Ribosome maturation factor RimM

185 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

19.887 kDa

MADRILVARIGAPHGVRGEVRLFVFTEDPGAVLDYDPLTDATGKKRFRIAALRAAKDHFVARIEGIADRTAAEALTNLDLFVPREALPPPDDDDTFYHADLIGLDVVDEAGVVIGKVVALQDFGAGDILEYAPTLPATKAKTLMVPFSKDAVPVVDVPGRRVVVAEAFVERRPAEPEEGEDTGGE

rimM

Ribosome maturation factor RimM

185 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.967 kDa

MVMMSKQLTAQAPVDPIVLGKMGSSYGIRGWLRVFSSTEDAESIFDYQPWFIQKAGQWQQVQLESWKHHNQDMIIKLKGVDDRDAANLLTNCEIVVDSSQLPQLEEGDYYWKDLMGCQVVTTEGYDLGKVVDMMETGSNDVLVIKANLKDAFGIKERLVPFLDGQVIKKVDLTTRSIEVDWDPGF

rimM

Ribosome maturation factor RimM

185 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.967 kDa

MVMMSKQLTAQAPVDPIVLGKMGSSYGIRGWLRVFSSTEDAESIFDYQPWFIQKAGQWQQVQLESWKHHNQDMIIKLKGVDDRDAANLLTNCEIVVDSSQLPQLEEGDYYWKDLMGCQVVTTEGYDLGKVVDMMETGSNDVLVIKANLKDAFGIKERLVPFLDGQVIKKVDLTTRSIEVDWDPGF

rimM

Ribosome maturation factor RimM

185 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.967 kDa

MVMMSKQLTAQAPVDPIVLGKMGSSYGIRGWLRVFSSTEDAESIFDYQPWFIQKAGQWQQVQLESWKHHNQDMIIKLKGVDDRDAANLLTNCEIVVDSSQLPQLEEGDYYWKDLMGCQVVTTEGYDLGKVVDMMETGSNDVLVIKANLKDAFGIKERLVPFLDGQVIKKVDLTTRSIEVDWDPGF

rimM

Ribosome maturation factor RimM

185 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.91 kDa

MVKMSKQLRIAAPVEPVVVGKMGSAYGIRGWLRVFSSTEEAESIFDYQPWFIKRAREWQPIGLESWKRHNQDLIIKVRDIEDREAATLLTNCEIVVDASQLPDLDSGEYYWKDLLGCQVVTVGGYQLGEVIDLMETGSNDVLVVKANLKDAFGIQERLIPFLDGKVIKNVDLAAHIIEVDWDPGF

rimM

Ribosome maturation factor RimM

184 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

21.292 kDa

MSMKGKETMSKQNEKLVVGKLGSSYGIRGWLKVFSYTDNPESIFDYSPWYIDQKGEWVEYKVEGWKRHNKGWVVKLQGLDVREDAHLLTNFEIAIDPASLPELSEDEFYWRELFGMQVVTTNGYDLGVVTDMMETGSNDVLVVKANLKDAFGQKERLIPFLEEQVIKVVDRQAQRIEVDWDPAF

rimM

Ribosome maturation factor RimM

184 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

21.292 kDa

MSMKGKETMSKQNEKLVVGKLGSSYGIRGWLKVFSYTDNPESIFDYSPWYIDQKGEWVEYKVEGWKRHNKGWVVKLQGLDVREDAHLLTNFEIAIDPASLPELSEDEFYWRELFGMQVVTTNGYDLGVVTDMMETGSNDVLVVKANLKDAFGQKERLIPFLEEQVIKVVDRQAQRIEVDWDPAF

rimM

Ribosome maturation factor RimM

184 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

21.374 kDa

MSMKGKETMSEQNERIVMGKLGSTYGIRGWLKVFSYTDNAESIFDYSPWYLKLKGEWVEYKVESWKRHGQGYVCKLAGLDVREDAQLMTNFEIAIDPASLPELSEDEFYWRELFGMQVFTTKGYNLGEVTDLLETGSNDVLVIKANLKDAFGQKERLIPYLEEQVIKKVDREARRIEVDWDPGF

rimM

Ribosome maturation factor RimM

184 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

19.88 kDa

MSAPSLNDLIELGAISEAQGLRGQVKIRPHSSEPVALLSSKSVWLSLIPRRDAGLSSPVEQASLTQYKVKSAKMHSGNVVIALEGVTDRDQALALKGARILVARDAFPKVETDSYYWIDLIGCNAINLQNETLGEVIDVTENGAHGVIAIGDASTKTIQYLVPFVKQVVQDVDLSNKTISLDWQ

rimM

Ribosome maturation factor RimM

184 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.513 kDa

MSHETGGADTAQDDEHVVLGRLTSPYGVKGWLKVYSYTSPIEGIFEHAEWVLSKRGERRACKLSQGRPHGKGLVASLEGISSRELAEQWAGADILLPKQALPALAPGDYYWYQLEGLRVETLDGECLGQVNYLFETGANDVLVIRPSEASLDERERLLPFLPDDVIRQVDLDAGRMIVDWDPEF

rimM

Ribosome maturation factor RimM

184 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.641 kDa

MNPADNILWGNIIKVHGVKGEVLVQVFSDDLTDYETLESVFVEIKQKQIPFFLSTFNFATQKRCILSFEDVTTVEQAKPLVGADIYIPVSKMAEADESRLSYQAIIGFEVMDTIQGKLGVISNFFQKTGQDLLMMDYQDAEILIPVTEEIVHSVDVKTKQVITTLPEGLIEIYLNEDASEPDAD

rimM

Ribosome maturation factor RimM

184 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

19.656 kDa

METIEVLVGRIGKPHGIRGELTLDVRTDEPERRFAPGAVLRAEPPAGSASRLRRVTVRSARWHQSTLLVAFEEVADRTAAEAARGILLHATVPADAAPDDPDEYYDHQLVGLAAYDVSGAALGSVTGLVHGGAQDLLTVRTPDGRDALVPFVKALVPEVDLAGRRVVIADRPGLVTPLPEDDEH

rimM

Ribosome maturation factor RimM

184 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

19.935 kDa

MQLQVARIGKPHGIRGEVTVQVLTDAPSERFVAGTEFVVEPASAGPLTIRSARWNKDILLLGFEEIADRNAAEVIRGAKLFIETEELSDEDDDEGWYEHELVGLEARVGSQVVGKVAALSTLPVQDLLTVTTEEGKEILIPFVDEIVPEVNVEGGYILITPPSGLFEINDENAKEPKDGAGDDA

rimM

Ribosome maturation factor RimM

184 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

19.649 kDa

MRPGAGANPSLPDDLVEVGYVGGAYGVRGWIKVQPHGDAEALLHASTWWLKPAAGAPAVSSDWRVLPVGTSREHSGSVVAGSPAVPDRNVAEALRGCTVWVRRAEFPAPADDEFYWVDLIGSTVVNEQQETLGTVAGLIDNGAHQILRIVDEGGTERLVPFVEVYVKSVDVAGKHIVVDWGLDY

rimM

Ribosome maturation factor RimM

184 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.732 kDa

MVSMLLVGRIGKSVGLNGGLRLHLESDFPECLKKGVKVSVAPLNAFFCTSSFKGYTIHSYEHAKNLLFLETIHTPEKAKELTNLGLFMSEAESKKLCVLKDGEFFYCDLVGLSVVEENETLGKVVEIQRISQIDYFMVETARSLVEKGLAKIFLIPYRDFYIKEILLQDKKITTNNAKTLLENS

rimM

Ribosome maturation factor RimM

184 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.792 kDa

MVSMLLVGRIGKSVGLNGGLRLHLESDFPECLKKGVKVSVAPLNAFSCVSSFKEYIIHSYEHAKNLLFLETIQTPEKAKELTNLGLFMSEAESKKLCVLKEGEFFYCDLVGLSVVEENEILGKVIEIQRISQTDYFLVETTLNLVEKGLAKIFLIPYRDFYIQEILLQDKKITTHNAKTLLENS

rimM

Ribosome maturation factor RimM

183 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.047 kDa

MVTPFPEVSEWLCIGQIVGAHGLRGEVKVKPFSDFPERFTVPGCRWLRSPRQPQPYAVTLLRGRFLPRAEQFVVTFAEISDRTAAEALKGAEILVPASDRPPLAANEYHLMDLIGLAVYHQGERVGEVVGLVNAGNDLLEVQLLDPAPKAPQSVYIPFVPAIVPVVDLAARRIEIDPPLGLLP

rimM

Ribosome maturation factor RimM

183 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.737 kDa

MMSKQLTAQAPVDPIVLGKMGSSYGIRGWLRVFSSTEDAESIFDYQPWFIQKAGQWQQVQLESWKHHNQDMIIKLKGVDDRDAANLLTNCEIVVDSSQLPQLEEGDYYWKDLMGCQVVTTEGYDLGKVVDMMETGSNDVLVIKANLKDAFGIKERLVPFLDGQVIKKVDLTTRSIEVDWDPGF

rimM

Ribosome maturation factor RimM

183 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.737 kDa

MMSKQLTAQAPVDPIVLGKMGSSYGIRGWLRVFSSTEDAESIFDYQPWFIQKAGQWQQVQLESWKHHNQDMIIKLKGVDDRDAANLLTNCEIVVDSSQLPQLEEGDYYWKDLMGCQVVTTEGYDLGKVVDMMETGSNDVLVIKANLKDAFGIKERLVPFLDGQVIKKVDLTTRSIEVDWDPGF

rimM

Ribosome maturation factor RimM

183 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

19.468 kDa

MELVVGRVAKSHGIKGEIVVEVRTDEPEDRFAVGAVLRGHKPREQTVSTYTVEAARDHSGRLLLRLEGVSDRTAADALRGTLFVIDSAELEPSDDPDEFYDHELEGLSVRLADGTEVGTVIEVLHSAAGELLSIRRAGDQSGELLVPFVAAIVTSVSVADGVALIDPPEGLLDPDFGESADGK

rimM

Ribosome maturation factor RimM

183 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

19.556 kDa

MELVVGRVAKSHGIKGEIVVEVRTDEPEDRFAVGAVLRGHKPREQTVNTYRVEAAREHSGRLLLRLEGVPDRTAADALRGTLFVIDSAELVPSDDPDEFYDHELEGLSVRLADGTELGAVIEVLHSAAGELLSIRRAGEQSGELLVPFVAAIVTSVSVADGVVVIDPPEGLLDPDFGESADGK

rimM

Ribosome maturation factor RimM

183 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.618 kDa

MMSKQDAAKAPVNPIVLGKMGSSYGIRGWLRVFSSTEDAESIFDYQPWFIQQAGQWQQVQLESWKHHNQDMIIKLKGVDDRDAANLLTNCEIVVDSSQLPDLEEGDYYWKDLIGCQVVTTEGYSLGKVIDMMETGSNDVLVVKANLKDAFGIKERLLPFLDGQVIKKVDLATQTIEVDWDPGF

rimM

Ribosome maturation factor RimM

183 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.511 kDa

MFTPVEAKKSNLITVGRITGVFGIKGWVKLKSFTDPQDNVLEYSPLLLKTKHGVKECEIAEYQFRPQGLVVRLKGVDDRNAAEALAPVDVAIDKSLLPELDDDDFYWHQLEGLRVVTIYEGNTQDLGVVSKVMATGANDVLEVKPDAQSIDDRDRLVPYVLDLYVKKVDLSAECITVDWDPEF

rimM

Ribosome maturation factor RimM

183 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.658 kDa

MMGKQLTAQVPAEPVVLGKMGSSYGIRGWLRVFSSTEDAESIFDYQPWFIQKADQWQQVQLESWKHHNQDLIIKLKGVDDRDAANLLTNCEIVVDSSQLPALEEGDYYWKDLMGCQVVTAEGYDLGKVIDMMETGSNDVLVIKANLKDAFGIKERLVPFLDGQVIKKVDLATRTIEVDWDPGF

rimM

Ribosome maturation factor RimM

183 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.585 kDa

MMSKQLAAQVPAEPVVLGKMGSSYGIRGWLRVFSSTEDAESIFDYLPWFIQKAGQWQQVQLESWKHHNQDLIIKLKGVDDRDAANLLTNCEIVVDSSQLPALEEGDYYWKDLMGCQVVTAEGYDLGKVIDMMETGSNDVLVIKANLKDAFGIKERLVPFLDGQVIKKVDLATRTIEVDWDPGF

rimM

Ribosome maturation factor RimM

182 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.619 kDa

MSKQLTAQAPVDPIVLGKMGSSYGIRGWLRVFSSTEDAESIFDYQPWFIQKAGQWQQVQLESWKHHNQDMIIKLKGVDDRDAANLLTNCEIVVDSSQLPQLEEGDYYWKDLMGCQVVTTEGYDLGKVIDMMETGSNDVLVIKANLKDAFGIKERLVPFLDGQVIKKVDLTTRSIEVDWDPGF

rimM

Ribosome maturation factor RimM

182 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.936 kDa

MSMKGKETMSNEKIVVGKFGATYGIRGWLKVFSYTDNAESIFDYSPWFINQKGTWVEYKVESWKRHNKGMVAKLEGLDIREDAHLLTNFEIAIDPAVLPELSEDEFYWRELFGMQVVTTKGYDLGVVSDILETGSNDVLVVKANLKDAFGQKERLIPFLEEQVIIKVDREAQRIEVDWDPGF

rimM

Ribosome maturation factor RimM

182 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

21.074 kDa

MKGKETMSKQNEKLVVGKLGSSYGIRGWLKVFSYTDNPESIFDYSPWYIDQKGEWVEYKVEGWKRHNKGWVVKLQGLDVREDAHLLTNFEIAIDPASLPELSEDEFYWRELFGMQVVTTNGYDLGVVTDMMETGSNDVLVVKANLKDAFGQKERLIPFLEEQVIKVVDRQAQRIEVDWDPAF

rimM

Ribosome maturation factor RimM

182 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

21.042 kDa

MSMKGKETMSNEKIVVGKFGATYGIRGWLKVFSYTDNAESIFDYSPWYINQKGKWVEYKVESWKRHNKGMVAKLEGMDVREDAHLMTNFEIAIDPAVLPELSEDEFYWRELFGMHVVTTKGYDLGVVTDMLETGSNDVLVVKANLKDAFGQKERLIPFLEEQVIIKVDREAQRIEVDWDPGF

rimM

Ribosome maturation factor RimM

182 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.965 kDa

MSMKGKETMSDERIVVGKFGSTYGIRGWLKVFSYTDNAESLFDYSPWYVNQKGEWVEFKVESWKRHNKGMVAKLEGLDVREDAHLLTNLEIAIDPAVLPELSEDEFYWRELFGMQVVTTNGYDLGVVTDMLETGSNDVLVVKANLKDAFGQKERLIPFLEEQVIIKVDREAQRIEVDWDPGF

rimM

Ribosome maturation factor RimM

182 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.965 kDa

MSMKGKETMSDERIVVGKFGSTYGIRGWLKVFSYTDNAESLFDYSPWYVNQKGEWVEFKVESWKRHNKGMVAKLEGLDVREDAHLLTNLEIAIDPAVLPELSEDEFYWRELFGMQVVTTNGYDLGVVTDMLETGSNDVLVVKANLKDAFGQKERLIPFLEEQVIIKVDREAQRIEVDWDPGF

rimM

Ribosome maturation factor RimM

182 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

19.941 kDa

MSESTTTIETAWLAIGQIVAPQGLRGEMRVNPSSDFPERFLIPGPRWLRRPRQTEPEVVELERGRAIAGKNLYIVQLAGITSREQAEALRGCELLVPASDRPELDEGEFHVLDLIDLSVIDQASSTPLGIVRDVVSAGNDLLVVELTDGREVYIPFVEAIVPVVDLAQGRIEITPPPGLLEL

rimM

Ribosome maturation factor RimM

182 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

19.941 kDa

MSESTTTIETAWLAIGQIVAPQGLRGEMRVNPSSDFPERFLIPGPRWLRRPRQTEPEVVELERGRAIAGKNLYIVQLAGITSREQAEALRGCELLVPASDRPELDEGEFHVLDLIDLSVIDQASSTPLGIVRDVVSAGNDLLVVELTDGREVYIPFVEAIVPVVDLAQGRIEITPPPGLLEL

rimM

Ribosome maturation factor RimM

182 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.502 kDa

MSKQLTAQAPVEPIVLGKMGSSYGIRGWLRVFSSTEDAESIFDYQPWFIQKAGQWQQVQLESWKHHNQDLIIKLKGVDDRDSANLLTNCEIVVDSSQLPALEDGSYYWKDLMGCQVVTTEGYDLGKVVDMMETGSNDVIVIKANLKDAFGIKERLVPFLDGQVIKKVDLATRTIEVDWDPGF

rimM

Ribosome maturation factor RimM

182 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.468 kDa

MSKQLAAQVPAEPVVLGKMGSSYGIRGWLRVFSSTEDAESIFDYQPWFIQKAGQWQQVQLESWKHHNQDLIIKLKGVDDRDAANLLTNCEIVVDSSQLPALEEGDYYWKDLMGCQVVTAEGYDLGKVIDMMETGSNDVLVIKANLKDAFGIKERLVPFLDGQVIKKVDLATRTIEVDWDPGF

rimM

Ribosome maturation factor RimM

182 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.468 kDa

MSKQLAAQVPAEPVVLGKMGSSYGIRGWLRVFSSTEDAESIFDYQPWFIQKAGQWQQVQLESWKHHNQDLIIKLKGVDDRDAANLLTNCEIVVDSSQLPALEEGDYYWKDLMGCQVVTAEGYDLGKVIDMMETGSNDVLVIKANLKDAFGIKERLVPFLDGQVIKKVDLATRTIEVDWDPGF

rimM

Ribosome maturation factor RimM

182 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.726 kDa

MSKQLKPVAPKQPIVLGKMGSTYGIRGWLRVFSSTENAESIFDYQPWLIQRSGQWQFVELEDWKRHSQDLIIKVKGIDDRDAANLLTNCEIVVDSEQLPPLEGDDYYWKDLMGCQVVTTSGYELGKVIDMMETGSNDVMVVRANLKDAFGMKERLVPFLHGQVIKKVDLTARVIEADWDPGF

rimM

Ribosome maturation factor RimM

182 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.605 kDa

MSKQLTAQAPVDPIVLGKMGSSYGIRGWLRVFSSTEDAESIFDYQPWFIQKAGQWQQVQLESWKHHNQDMIIKLKGVDDRDAANLLTNCEIVVDSSQLPQLEEGDYYWKDLMGCQVVTTEGYDLGKVVDMMETGSNDVLVIKANLKDAFGIKERLVPFLDGQVIKKVDLTTRSIEVDWDPGF

rimM

Ribosome maturation factor RimM

182 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.392 kDa

MSNQLSPKPPVNPIVMGKIGSAYGIRGWLRVFSSTEDADSIFDYQPWFIQSKSGWQLVEIEGWKYHNQDLIIKVKGADDRDAANLLTNCEIVVDSSQLPDLGVGDYYWKDLIGCQVVTVTGYELGKIIDMMETGSNDVMVIKANLKDAFGVKERLVPFLTEQVVKRVDLSAQTIEVDWDPGF

rimM

Ribosome maturation factor RimM

182 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.47 kDa

MSNQLSPKPPVNPIVMGKIGSAYGIRGWLRVFSSTEDAESIFDYQPWFIQSKSGWQLVEIEGWKYHNQDLIIKVKGTDDRDAANLLTNCEIVVDSSQLPDLGEGDYYWKDLMGCQVVTVAGYELGKVIDMMETGSNDVMVIKANLKDAFGVKERLVPFLTEQVVKRVDLSTQTIEVDWDPGF

rimM

Ribosome maturation factor RimM

182 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.605 kDa

MSKQLTAQAPVDPIVLGKMGSSYGIRGWLRVFSSTEDAESIFDYQPWFIQKAGQWQQVQLESWKHHNQDMIIKLKGVDDRDAANLLTNCEIVVDSSQLPQLEEGDYYWKDLMGCQVVTTEGYDLGKVVDMMETGSNDVLVIKANLKDAFGIKERLVPFLDGQVIKKVDLTTRSIEVDWDPGF

rimM

Ribosome maturation factor RimM

182 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.605 kDa

MSKQLTAQAPVDPIVLGKMGSSYGIRGWLRVFSSTEDAESIFDYQPWFIQKAGQWQQVQLESWKHHNQDMIIKLKGVDDRDAANLLTNCEIVVDSSQLPQLEEGDYYWKDLMGCQVVTTEGYDLGKVVDMMETGSNDVLVIKANLKDAFGIKERLVPFLDGQVIKKVDLTTRSIEVDWDPGF

rimM

Ribosome maturation factor RimM

182 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.605 kDa

MSKQLTAQAPVDPIVLGKMGSSYGIRGWLRVFSSTEDAESIFDYQPWFIQKAGQWQQVQLESWKHHNQDMIIKLKGVDDRDAANLLTNCEIVVDSSQLPQLEEGDYYWKDLMGCQVVTTEGYDLGKVVDMMETGSNDVLVIKANLKDAFGIKERLVPFLDGQVIKKVDLTTRSIEVDWDPGF

rimM

Ribosome maturation factor RimM

182 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.605 kDa

MSKQLTAQAPVDPIVLGKMGSSYGIRGWLRVFSSTEDAESIFDYQPWFIQKAGQWQQVQLESWKHHNQDMIIKLKGVDDRDAANLLTNCEIVVDSSQLPQLEEGDYYWKDLMGCQVVTTEGYDLGKVVDMMETGSNDVLVIKANLKDAFGIKERLVPFLDGQVIKKVDLTTRSIEVDWDPGF

rimM

Ribosome maturation factor RimM

182 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.605 kDa

MSKQLTAQAPVDPIVLGKMGSSYGIRGWLRVFSSTEDAESIFDYQPWFIQKAGQWQQVQLESWKHHNQDMIIKLKGVDDRDAANLLTNCEIVVDSSQLPQLEEGDYYWKDLMGCQVVTTEGYDLGKVVDMMETGSNDVLVIKANLKDAFGIKERLVPFLDGQVIKKVDLTTRSIEVDWDPGF

rimM

Ribosome maturation factor RimM

182 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.605 kDa

MSKQLTAQAPVDPIVLGKMGSSYGIRGWLRVFSSTEDAESIFDYQPWFIQKAGQWQQVQLESWKHHNQDMIIKLKGVDDRDAANLLTNCEIVVDSSQLPQLEEGDYYWKDLMGCQVVTTEGYDLGKVVDMMETGSNDVLVIKANLKDAFGIKERLVPFLDGQVIKKVDLTTRSIEVDWDPGF

rimM

Ribosome maturation factor RimM

182 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.605 kDa

MSKQLTAQAPVDPIVLGKMGSSYGIRGWLRVFSSTEDAESIFDYQPWFIQKAGQWQQVQLESWKHHNQDMIIKLKGVDDRDAANLLTNCEIVVDSSQLPQLEEGDYYWKDLMGCQVVTTEGYDLGKVVDMMETGSNDVLVIKANLKDAFGIKERLVPFLDGQVIKKVDLTTRSIEVDWDPGF

rimM

Ribosome maturation factor RimM

182 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.605 kDa

MSKQLTAQAPVDPIVLGKMGSSYGIRGWLRVFSSTEDAESIFDYQPWFIQKAGQWQQVQLESWKHHNQDMIIKLKGVDDRDAANLLTNCEIVVDSSQLPQLEEGDYYWKDLMGCQVVTTEGYDLGKVVDMMETGSNDVLVIKANLKDAFGIKERLVPFLDGQVIKKVDLTTRSIEVDWDPGF

rimM

Ribosome maturation factor RimM

182 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.605 kDa

MSKQLTAQAPVDPIVLGKMGSSYGIRGWLRVFSSTEDAESIFDYQPWFIQKAGQWQQVQLESWKHHNQDMIIKLKGVDDRDAANLLTNCEIVVDSSQLPQLEEGDYYWKDLMGCQVVTTEGYDLGKVVDMMETGSNDVLVIKANLKDAFGIKERLVPFLDGQVIKKVDLTTRSIEVDWDPGF

rimM

Ribosome maturation factor RimM

182 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.605 kDa

MSKQLTAQAPVDPIVLGKMGSSYGIRGWLRVFSSTEDAESIFDYQPWFIQKAGQWQQVQLESWKHHNQDMIIKLKGVDDRDAANLLTNCEIVVDSSQLPQLEEGDYYWKDLMGCQVVTTEGYDLGKVVDMMETGSNDVLVIKANLKDAFGIKERLVPFLDGQVIKKVDLTTRSIEVDWDPGF

rimM

Ribosome maturation factor RimM

182 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.605 kDa

MSKQLTAQAPVDPIVLGKMGSSYGIRGWLRVFSSTEDAESIFDYQPWFIQKAGQWQQVQLESWKHHNQDMIIKLKGVDDRDAANLLTNCEIVVDSSQLPQLEEGDYYWKDLMGCQVVTTEGYDLGKVVDMMETGSNDVLVIKANLKDAFGIKERLVPFLDGQVIKKVDLTTRSIEVDWDPGF

rimM

Ribosome maturation factor RimM

182 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.605 kDa

MSKQLTAQAPVDPIVLGKMGSSYGIRGWLRVFSSTEDAESIFDYQPWFIQKAGQWQQVQLESWKHHNQDMIIKLKGVDDRDAANLLTNCEIVVDSSQLPQLEEGDYYWKDLMGCQVVTTEGYDLGKVVDMMETGSNDVLVIKANLKDAFGIKERLVPFLDGQVIKKVDLTTRSIEVDWDPGF

rimM

Ribosome maturation factor RimM

182 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.605 kDa

MSKQLTAQAPVDPIVLGKMGSSYGIRGWLRVFSSTEDAESIFDYQPWFIQKAGQWQQVQLESWKHHNQDMIIKLKGVDDRDAANLLTNCEIVVDSSQLPQLEEGDYYWKDLMGCQVVTTEGYDLGKVVDMMETGSNDVLVIKANLKDAFGIKERLVPFLDGQVIKKVDLTTRSIEVDWDPGF

rimM

Ribosome maturation factor RimM

182 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.605 kDa

MSKQLTAQAPVDPIVLGKMGSSYGIRGWLRVFSSTEDAESIFDYQPWFIQKAGQWQQVQLESWKHHNQDMIIKLKGVDDRDAANLLTNCEIVVDSSQLPQLEEGDYYWKDLMGCQVVTTEGYDLGKVVDMMETGSNDVLVIKANLKDAFGIKERLVPFLDGQVIKKVDLTTRSIEVDWDPGF

rimM

Ribosome maturation factor RimM

182 amino acids

One of at least 4 proteins (Era, RbfA, RimM and RsgA/YjeQ) that assist in the late assembly stage of the 30S ribosomal subunit. An accessory protein needed during the final step in assembly of the 30S ribosomal subunit, for assembly of the head region (the 16S rRNA 3' domain) (PubMed:11514519, PubMed:15496525, PubMed:20188109, PubMed:23611982, PubMed:27382067). It may act while Era is associated and before RimP in 30S subunit assembly (PubMed:20188109). Interacts with S19 (PubMed:15496525). Essential for efficient processing of 16S rRNA; a deletion mutant accumulates 17S rRNA (PubMed:9422595). Deletions also do not assemble the head-associated ribosomal proteins correctly (PubMed:23611982, PubMed:27382067). May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes (PubMed:9226267).

Belongs to the RimM family.

20.605 kDa

MSKQLTAQAPVDPIVLGKMGSSYGIRGWLRVFSSTEDAESIFDYQPWFIQKAGQWQQVQLESWKHHNQDMIIKLKGVDDRDAANLLTNCEIVVDSSQLPQLEEGDYYWKDLMGCQVVTTEGYDLGKVVDMMETGSNDVLVIKANLKDAFGIKERLVPFLDGQVIKKVDLTTRSIEVDWDPGF

rimM

Ribosome maturation factor RimM

182 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.605 kDa

MSKQLTAQAPVDPIVLGKMGSSYGIRGWLRVFSSTEDAESIFDYQPWFIQKAGQWQQVQLESWKHHNQDMIIKLKGVDDRDAANLLTNCEIVVDSSQLPQLEEGDYYWKDLMGCQVVTTEGYDLGKVVDMMETGSNDVLVIKANLKDAFGIKERLVPFLDGQVIKKVDLTTRSIEVDWDPGF

rimM

Ribosome maturation factor RimM

182 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.605 kDa

MSKQLTAQAPVDPIVLGKMGSSYGIRGWLRVFSSTEDAESIFDYQPWFIQKAGQWQQVQLESWKHHNQDMIIKLKGVDDRDAANLLTNCEIVVDSSQLPQLEEGDYYWKDLMGCQVVTTEGYDLGKVVDMMETGSNDVLVIKANLKDAFGIKERLVPFLDGQVIKKVDLTTRSIEVDWDPGF

rimM

Ribosome maturation factor RimM

182 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.605 kDa

MSKQLTAQAPVDPIVLGKMGSSYGIRGWLRVFSSTEDAESIFDYQPWFIQKAGQWQQVQLESWKHHNQDMIIKLKGVDDRDAANLLTNCEIVVDSSQLPQLEEGDYYWKDLMGCQVVTTEGYDLGKVVDMMETGSNDVLVIKANLKDAFGIKERLVPFLDGQVIKKVDLTTRSIEVDWDPGF

rimM

Ribosome maturation factor RimM

182 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.795 kDa

MSKQLNPVVPEQPIVLGKMGSTYGIRGWLRVFSSTENAESIFDYQPWFIQQGGKWQHVELEDWKRHSQDLIIKVKGVDDRDAANLLTNCEIVVDSKQLPELEEDDYYWKDLMGCQVVTTAGYELGKIIDMMETGSNDVMVVKANLKDAFGMKERLVPFLHGQVIKNVDLTAQRVEVDWDPGF

rimM

Ribosome maturation factor RimM

182 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.774 kDa

MSKQLNPAVPDQPIVLGKMGSTYGIRGWLRVFSSTENAESIFDYQPWFIQQAGKWQHVELEDWKRHSQDLIIKVKGVDDRDAANLLTNCEIFVDSTQLPALEEDDYYWKDLMGCQVVTTTGYELGKIIDMMETGSNDVMVVKANLKDAFGMKERLVPFLHGQVIKKVDLTAQRVEVDWDPGF

rimM

Ribosome maturation factor RimM

182 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.754 kDa

MSKQLNPAVPDQPIVLGKMGSTYGIRGWLRVFSSTENAESIFDYQPWFIQQAGKWQHVELEDWKRHSQDLIIKVKGVDDREAANLLTNCEIIVDSTQLPALEEDDYYWKDLMGCQVVTTTGYELGKIIDMMETGSNDVMVVKANLKDAFGMKERLVPFLHGQVIKKVDLTAQRVEVDWDPGF

rimM

Ribosome maturation factor RimM

182 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

19.12 kDa

MPSGPISVARQVCVARIGAPHGVRGAMRLWSFTADPLAVGDYGPLSTKDGTRSFEIATARAAKDHLVVTLKGVTTRDEAVRLNGLELYVPRDALPPTEDDEYYHADLIGLPAITTSGEPLGRVLAIHNFGAGDIIEIAPASGPTLLLPFTNAVVPTVDLAAGQVIIELPAEIEGDTPNHPEA

rimM

Ribosome maturation factor RimM

182 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.774 kDa

MSKQLNPAVPDQPIVLGKMGSTYGIRGWLRVFSSTENAESIFDYQPWFIQQAGKWQHVELEDWKRHSQDLIIKVKGVDDRDAANLLTNCEIFVDSTQLPALEEDDYYWKDLMGCQVVTTTGYELGKIIDMMETGSNDVMVVKANLKDAFGMKERLVPFLHGQVIKKVDLTAQRVEVDWDPGF

rimM

Ribosome maturation factor RimM

182 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.754 kDa

MSKQLNPAVPDQPIVLGKMGSTYGIRGWLRVFSSTENAESIFDYQPWFIQQAGKWQHVELEDWKRHSQDLIIKVKGVDDREAANLLTNCEIIVDSTQLPALEEDDYYWKDLMGCQVVTTTGYELGKIIDMMETGSNDVMVVKANLKDAFGMKERLVPFLHGQVIKKVDLTAQRVEVDWDPGF

rimM

Ribosome maturation factor RimM

182 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.754 kDa

MSKQLNPAVPDQPIVLGKMGSTYGIRGWLRVFSSTENAESIFDYQPWFIQQAGKWQHVELEDWKRHSQDLIIKVKGVDDREAANLLTNCEIIVDSTQLPALEEDDYYWKDLMGCQVVTTTGYELGKIIDMMETGSNDVMVVKANLKDAFGMKERLVPFLHGQVIKKVDLTAQRVEVDWDPGF

rimM

Ribosome maturation factor RimM

182 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.754 kDa

MSKQLNPAVPDQPIVLGKMGSTYGIRGWLRVFSSTENAESIFDYQPWFIQQAGKWQHVELEDWKRHSQDLIIKVKGVDDREAANLLTNCEIIVDSTQLPALEEDDYYWKDLMGCQVVTTTGYELGKIIDMMETGSNDVMVVKANLKDAFGMKERLVPFLHGQVIKKVDLTAQRVEVDWDPGF

rimM

Ribosome maturation factor RimM

182 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.768 kDa

MSKQLNPAVPDQPIVLGKMGSTYGIRGWLRVFSSTENAESIFDYQPWFIQQAGKWQHVELEDWKRHSQDLIIKVKGVDDREAANLLTNCEIIVDSTQLPALEEDDYYWKDLMGCQVVTTTGYELGKIIDMMETGSNDVMLVKANLKDAFGMKERLVPFLHGQVIKKVDLTAQRVEVDWDPGF

rimM

Ribosome maturation factor RimM

182 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.774 kDa

MSKQLNPAVPDQPIVLGKMGSTYGIRGWLRVFSSTENAESIFDYQPWFIQQAGKWQHVELEDWKRHSQDLIIKVKGVDDRDAANLLTNCEIFVDSTQLPALEEDDYYWKDLMGCQVVTTTGYELGKIIDMMETGSNDVMVVKANLKDAFGMKERLVPFLHGQVIKKVDLTAQRVEVDWDPGF

rimM

Ribosome maturation factor RimM

182 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.754 kDa

MSKQLNPAVPDQPIVLGKMGSTYGIRGWLRVFSSTENAESIFDYQPWFIQQAGKWQHVELEDWKRHSQDLIIKVKGVDDREAANLLTNCEIIVDSTQLPALEEDDYYWKDLMGCQVVTTTGYELGKIIDMMETGSNDVMVVKANLKDAFGMKERLVPFLHGQVIKKVDLTAQRVEVDWDPGF

rimM

Ribosome maturation factor RimM

182 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.619 kDa

MSKQLTAQAPVDPIVLGKMGSSYGIRGWLRVFSSTEDAESIFDYQPWFIQKAGQWQQVQLESWKHHNQDMIIKLKGVDDRDAANLLTNCEIVVDSSQLPQLEEGDYYWKDLMGCQVVTTEGYDLGKVIDMMETGSNDVLVIKANLKDAFGIKERLVPFLDGQVIKKVDLTTRSIEVDWDPGF

rimM

Ribosome maturation factor RimM

182 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.605 kDa

MSKQLTAQAPVDPIVLGKMGSSYGIRGWLRVFSSTEDAESIFDYQPWFIQKAGQWQQVQLESWKHHNQDMIIKLKGVDDRDAANLLTNCEIVVDSSQLPQLEEGDYYWKDLMGCQVVTTEGYDLGKVVDMMETGSNDVLVIKANLKDAFGIKERLVPFLDGQVIKKVDLTTRSIEVDWDPGF

rimM

Ribosome maturation factor RimM

182 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.605 kDa

MSKQLTAQAPVDPIVLGKMGSSYGIRGWLRVFSSTEDAESIFDYQPWFIQKAGQWQQVQLESWKHHNQDMIIKLKGVDDRDAANLLTNCEIVVDSSQLPQLEEGDYYWKDLMGCQVVTTEGYDLGKVVDMMETGSNDVLVIKANLKDAFGIKERLVPFLDGQVIKKVDLTTRSIEVDWDPGF

rimM

Ribosome maturation factor RimM

182 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.818 kDa

MTPTQNVPEDRIQIGQLRSAYGLNGWLWVYSNTEPMSNMFDYLPWFIETKAGWQTVDVKRWKPHGKGLVVSLKNVSDRNAAESLIGSTIWVAKSQLPKTDVDEYYWSDLKGLTVLGLDEEEQEVNLGQIHELFETGANDVMVVRATADSVDAEERMIPWHKDVVQRVDLEAGRIYVNWGVDY

rimM

Ribosome maturation factor RimM

182 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.562 kDa

MSKQHTAQAPVDPIVLGKMGSSYGIRGWLRVFSSTEDAESIFDYQPWLIQKAGQWQVVELEGWRHHNQDIIIKLKGVDDRDAANLLTNCEIIVDSSQLPELEEGDYYWKDLMGCQVVTTEGYSLGKVIDMMETGSNDVLVIKANLKDAFGIKERLVPFLDGQVIKKVDLTTRTIEVDWDPGF

rimM

Ribosome maturation factor RimM

182 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.592 kDa

MSKQHTAQAPVDPIVLGKMGSSYGIRGWLRVFSSTEDAESIFDYQPWLIQKAGQWQVVELESWRHHNQDIIIKLKGVDDRDAANLLTNCEIIVDSSQLPELEEGDYYWKDLMGCQVVTTEGYSLGKVIDMMETGSNDVLVIKANLKDAFGIKERLVPFLDGQVIKKVDLTTRTIEVDWDPGF

rimM

Ribosome maturation factor RimM

182 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.136 kDa

MMEERPSADEVLLIGKVIDAFGLRGEIKIRAITDQVDHLRRHVRTVFLGEERRPFTLQRVHEPKAGILILSLGGVTDRTTAEALRGAEVTIRECDAAPLDQDEYFIHQLYGLRVIESGGGEIGVVREVVQTGANDVIVVERQGRSDTLLPMIHDVVERLDVAAGQIVVRLLPGLIDDDNQEG

rimM

Ribosome maturation factor RimM

182 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.468 kDa

MSKQLAAQVPAEPVVLGKMGSSYGIRGWLRVFSSTEDAESIFDYQPWFIQKAGQWQQVQLESWKHHNQDLIIKLKGVDDRDAANLLTNCEIVVDSSQLPALEEGDYYWKDLMGCQVVTAEGYDLGKVIDMMETGSNDVLVIKANLKDAFGIKERLVPFLDGQVIKKVDLATRTIEVDWDPGF

rimM

Ribosome maturation factor RimM

182 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.516 kDa

MSKQLAAQVPAEPVVLGKMGSSYGIRGWLRVFSSTEDAESIFDYQPWFIQKAGQWQQVQLESWKHHNQDLIIKLKGVDDRDAANLLTNCEIVVDSSQLPALEEGDYYWKDLMGCQVVTAEGYDLGKVIDMMETGSNDVLVIKANLKDAFGIKERLVPFLYGQVIKKVDLATRTIEVDWDPGF

rimM

Ribosome maturation factor RimM

182 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.468 kDa

MSKQLAAQVPAEPVVLGKMGSSYGIRGWLRVFSSTEDAESIFDYQPWFIQKAGQWQQVQLESWKHHNQDLIIKLKGVDDRDAANLLTNCEIVVDSSQLPALEEGDYYWKDLMGCQVVTAEGYDLGKVIDMMETGSNDVLVIKANLKDAFGIKERLVPFLDGQVIKKVDLATRTIEVDWDPGF

rimM

Ribosome maturation factor RimM

182 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.468 kDa

MSKQLAAQVPAEPVVLGKMGSSYGIRGWLRVFSSTEDAESIFDYQPWFIQKAGQWQQVQLESWKHHNQDLIIKLKGVDDRDAANLLTNCEIVVDSSQLPALEEGDYYWKDLMGCQVVTAEGYDLGKVIDMMETGSNDVLVIKANLKDAFGIKERLVPFLDGQVIKKVDLATRTIEVDWDPGF

rimM

Ribosome maturation factor RimM

182 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.468 kDa

MSKQLAAQVPAEPVVLGKMGSSYGIRGWLRVFSSTEDAESIFDYQPWFIQKAGQWQQVQLESWKHHNQDLIIKLKGVDDRDAANLLTNCEIVVDSSQLPALEEGDYYWKDLMGCQVVTAEGYDLGKVIDMMETGSNDVLVIKANLKDAFGIKERLVPFLDGQVIKKVDLATRTIEVDWDPGF

rimM

Ribosome maturation factor RimM

181 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

19.541 kDa

MQQWLEIGKVVAAQGLRGEVRVQPATDFAERLTRPGARLVGRSLDDGRVFRLQSGRAIPGKDLFVCRFEGVEERNAAEKLVGSTLWIGAAERPVLAAGEFWLPDLMGVRVFRQDTGEAIGEVSDMTRAGNDLLVIRLSGGKTVMVPFVHALVPVVDLEAGRIEVVAIPGLLDPEAAEADEA

rimM

Ribosome maturation factor RimM

181 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.464 kDa

MSELKQAAAPEQALVVGRITSVYGVKGWVKLYSHTEPMQGIFDYKHWWLKTPSGWKTVELSQGRLQGRGLVASVKGYTDRDQVKDICGMDVYIDAAELPELEEGDYYWSQLEGLRVITKEGVLLGKVSQLMETGANDVIVVRACEGSFDREERLIPYAPGTYVLNIDLEQQEMVVDWDPEF

rimM

Ribosome maturation factor RimM

181 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.489 kDa

MKYNKEKLKNKVYLAIIGMPHGIRGDVFVKILSADPQRFKSYGTLYDDMGRSYEIVTLRTQKNNAIVRFKGVENRNAAESLKGIHLYVMRDQLIDDLREDEFYQVDLIGLRVQEYGGKILGEVCGFCNFGAGDLLEIRLNTGKRMLIPFSKVAVPEICMDSGFLIVDPMAAGLRDGEENDQ

rimM

Ribosome maturation factor RimM

181 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.487 kDa

MLLVGRIGKSVGLNGGLKLHLESDFPECLKKGVKVSVAPINAFSRASSFKDYVIHSYEHAKNLLFLETIHTPEKAKELTNLGLFMSEAESKKLCVLKEGEFFYCDLVGLSVVEENEFLGKVIEIQRISQIDYFLVETTKSLVEKGLAKIFLIPYRDFYIQEILLQDKKITTHNAKTLLENS

rimM

Ribosome maturation factor RimM

181 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.395 kDa

MLLVGRIGKSVGLNGGLKLHLESDFPECLKKGVKVSVAPINAFSCASSFKDYVIHSYEHAKNLLFLETIRTPEKAKELTNLGLFMSEAESKKLCVLKEGEFFYCDLIGLSVVEGNEILGKVIEIQRISQTDYFMVETTRSLVEKGLAKIFLIPYRDFYIQEILLQDKKITTHNAKTLLENS

rimM

Ribosome maturation factor RimM

181 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.376 kDa

MMSSKQDEKIILGQINGIYGVQGWVKIFSHTDPRQNILSYSPWLVKVKNEWRTFQVEEGRAQQGGKSVVAKLEGIDDRDLAREYIGCEIAILPEQLPATEEGFYWMQLIGCQVTSVEGEDLGQVTEIVETGAHDVLRVEKQSDAGLVSTLIPFVMETFILDVDVESKQIQVDWQLEDATES

rimM

Ribosome maturation factor RimM

181 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

19.982 kDa

MSADTKTQRLIPMGVLKGAHGVRGEVRVKSFTADPDALFTYGPLMDEAGKVLLTPITARPGKDHFIVRPKENLQKEDWDALRGCLLHASRDQLPEADEDEFYFEDLIGMPVYTVGEEPEARVRAVQNFGSGDLLEIEIPGAPATIYVPLTRADVPVIDMAAHRIVIPELSLWANQDEDDAS

rimM

Ribosome maturation factor RimM

180 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

18.875 kDa

MTEPIVVGRIGRPHGVRGDVTIEVRTDLPQRRFALGAVLGREGGGAPLTVAEARWHSGRLLLRFQGVEDRGAAEALRDVLLTIDSAEAGPPVDDDEDAEGEGGDIWWDRDLVGLEAVTTAGATLGRVTDVIHAPAGDLLAVGRPGGGEHLVPFVREIVPTVDPAAGRIVVDPPPGLLDLD

rimM

Ribosome maturation factor RimM

180 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

21.302 kDa

MTKKFLNIHLTIAKFGAAHGILGWIRVFSYTEKKENIFDYVPWFIKKEQKIIKILPKYWKILKKTFLVKINDVNNRSMAQKLTNYDILINQKTLPKLNNNEYYWKDIVDCTVFDTNFIKLGRVSELIRTPSNDILVVKASNIKNISQNDMLIPFLHPQIISEVNINNKKIVIKNWKQTFE

rimM

Ribosome maturation factor RimM

180 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

19.754 kDa

MADSEEWLEEWLTVGKIVGVQGLQGELRVNPASDFPERFTVPGPRWVRSKGSPPREMQLKTGRQLPGKSLFVVRLDSVDNRDAAEALVGSDWMVPADDRPQLGEGEFHLLDLVGLEARLSPDSDPIGTVTDLISGGNDLLEIKRTDGSKLLIPFVEAIVPEVHLKDGWLLLTPPPGLMDL

rimM

Ribosome maturation factor RimM

180 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.499 kDa

MIKREDVYKIGLFNKPHGIHGELSFTFTDDIFDRADCDYLICRLDDIFVPFFIEEYRFRSDSTALVKLEGVDTAERARMFTNVEVYFPVKHAEEAGPGELSWDFFVGFRVEDVRHGALGKVTDVDTSTVNTLFVVDRDGDELLIPAQEELIAGIDQKHKIITVDLPEGLLSLDECDDEES

rimM

Ribosome maturation factor RimM

180 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.499 kDa

MIKREDVYKIGLFNKPHGIHGELSFTFTDDIFDRADCDYLICRLDDIFVPFFIEEYRFRSDSTALVKLEGVDTAERARMFTNVEVYFPVKHAEEAGPGELSWDFFVGFRVEDVRHGALGKVTDVDTSTVNTLFVVDRDGDELLIPAQEELIAGIDQKHKIITVDLPEGLLSLDECDDEES

rimM

Ribosome maturation factor RimM

180 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

19.229 kDa

MLVVGRIGKPHGIRGEVTVEVRTDEPETRFAPGSVLRTEPGANVPAHPGAYRVPGELTVEAARWHQGRVLLVTFEGVLDRNVAEALRGTLVGVDRADVAPPTDPEEFHDHQLVGLAVVTSAGERLGEIARIDHAPAADLLVLRRPGRRDVLIPFVQAIVPEIDLAGGRVVVDPPGGLLDL

rimM

Ribosome maturation factor RimM

180 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

19.842 kDa

MKYNREKLKNKVCLAIIGMPHGIKGDVLLKILSSEPQRLKTYGTLYDDRGHSYEIVMLRMQKKNAIVHFKGVEDRSAAEALRGIHLYVARDQLVDDLTEDEFYQVDLIGLRVQDCTGRILGEVSGLFNFGAGDLLEMRLNTGKTVLIPFSKAAVLEVCIASGFLVVDPVAAGLSDGGENT

rimM

Ribosome maturation factor RimM

180 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.206 kDa

MLPPGLESTQMKQTERRILLGRIVGAFGVKGELKLESWTEPRTAIFRYQPWIVRAPSGQESVVSGVRGRDQGKNLIAVFPGVTDRDTVEAMHGTEIYVARSALPPPKPDEYYWVDLEELQVETVEGVKLGTVSHLFSTGSNDVVVVRGDRERMIPFVFPDFVKSVDFDANLIVVDWDPDF

rimM

Ribosome maturation factor RimM

180 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.415 kDa

MLLVGRIGKSVGLNGGLKLHLESDFPECLKKGVKVSVAPLNAFSHASFKDYVIHSYEHAKNLLFLETINTPEMARELTNLGLFMSETESKKLCVLKEGEFFYCDLIGLSVVEENEILGKVIEIQRISHIDYFMVETTLNLVEKGLAKIFLIPYRDFYIKEILLQDKKITTNNAKTLLENS

rimM

Ribosome maturation factor RimM

180 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

19.463 kDa

MDDKQPLTLAVGRIVRPHGVRGELVVEVRTDSPELRFAPGSVLGMRRRGAHASENFTVAAARPHAGRLLVRAEGVEGREAAEELRGALLTVTADELESTDDPDEFHDHQLEGLRVVFPAGEEAGVVAEVVHTPAGELLAVRTPDDREVLVPFVSEMVPEIDLEAGRIVVDPPEGLFDAEE

rimM

Ribosome maturation factor RimM

180 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

19.262 kDa

MLVVGRIGKPHGIRGEVTVEVRTDEPETRFAPGSVLRTEPGANVPASPGAYRVPSELTVETARWHQGRLLLVAFEGVLDRNVAEALRGTFVGVDRADVTAPTDPEEFHDHQLVGLAVVTSAGERLGEIVRIDHAPAADLLVLRRPGDRDVLIPFVRAIVPEVDLAGGRVVVDPPGGLLDL

rimM

Ribosome maturation factor RimM

179 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

18.807 kDa

MAEEIVVGRIGRPHGIRGEVTIEIRTDVPHRRFVVGAVLGREGGGTALTVSGAHWHSGRLLLHFRGVDDRGAAEALRGVLLTIDADQAGSPLDDADGDGEAVEMWWDRDLVGLRAVTTAGMLLGHVTDIIHSPAGDLLAIGGPDGGEHLVPFVRDIVPTVDPPAGRIVVDPPPGLLDLD

rimM

Ribosome maturation factor RimM

179 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.652 kDa

MINNNKWLVVGLITSCHGINGQLKVKSLSDFEERFLKPGIRWLQKENEPPSKIELTSGFKQPGKETFIIKLQGINNRNQAERLKKCKILVKTNKLPKLKKEEFHLLELINLEVKTLENEELKIIGKVINLENEKNNLLVVELFKNKKKVLIPFVKEIVPLVDIKNNFLIINPPNGLLDL

rimM

Ribosome maturation factor RimM

179 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.344 kDa

MINHNEWLIVGLITSPQGINGKIKIKSLSDFEERFTKPGKRWIQKGNETPIEFELTHGFKKPGKESFIITFKGINNRTQAENLKGQKILVKVDAIPKLSHGEYHLTELINLNVKISENNQLHIIGKVINLSNEKNNLLVIQLLKNNKEVLIPFVKEIVPIVDIKKNFILLTPPSGLLEL

rimM

Ribosome maturation factor RimM

179 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.773 kDa

MIIKNEWLIVGFITSCHGINGQLKVKSLSDFEERFLKPGMRWLQKESEHPSKIELISGFKQPGKEIFIVKFKGINTRNHAEQLKKCKLLVKSDKLPKLKKEEFHLLELIDLEVKTLENDELKIIGKVINLENEKNNLLIIELFKNQKKVLIPFVKEIVPLVDIKNNFLIINPPNGLLEL

rimM

Ribosome maturation factor RimM

179 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.101 kDa

MNATPASADDLIVIGKIYSVHGVRGEVKVFSFTDPIGNLLDYKTWTLRREGSVEKQVELVSGRLQSKFLVAKLKGLDDREEARLLSGYEICVPRNLFPDLDDGEYYWYQLEGLKVIDQLGQLLGKIDHLLETGSNDVMVVKPCAGSLDDRERLLPYTEQCVLAIDMAAGEMKVDWDADF

rimM

Ribosome maturation factor RimM

179 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

19.977 kDa

MDLLATGRIRGTFGIEGFVKVESFSGEYEHFLGFDRVFLSILKEKLREQKYKDGWFEIEEVNLRKADALVKFKGIDNPEAAKCLTGSELFIPRDKAAPLDEGEVYVHDLCNCNLVCEGTLVGKITSVAEGGGGYLLEIAGKTSEAAAESSFYVPFNKEFIGKIDLKAKTVELMHRWILE

rimM

Ribosome maturation factor RimM

179 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.678 kDa

MINKNEWLTVGLITSCHGINGQVKVKSLSDFEERFLKPGMRWLQKENEPPSKIELISGFKQPGKETFIVKLQGINTRNDAEQLKTFKILVRTDKLPKLKKEEFHLLELINLEVKTLENDELKTIGKVINLENEKNNLLIIELFKNQKKVLIPFVKEIVPLVDIKNQFVIINPPNGLLEL

rimM

Ribosome maturation factor RimM

179 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.733 kDa

MINKNKWLTVGLITSCHGINGQVKVKSLSDFEERFLKPGMRWLQKEDEPPSKIELISGFKQPGKQTFVIKLKDINSRNHAEQLKKFKILVKTNEIPKLKKEEFHLLELINLKVNTLENDKLNTIGKVINLENEKNNLLVIKLFKNQKEVFIPFVKEIVPIVDIKNNFIIINPPNGLLEL

rimM

Ribosome maturation factor RimM

179 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.646 kDa

MINHDEWLIVGLITSPQGINGKIKVKSLSDFEERFTKPGIRWIQKETESPKKLQLISGFQKPGKESFVITFKEIKNRNEAEKLKGYKLLVKVDEIPKLNKNEFHLTELMNLKVKILENNKLKIIGKVVNLENEKNNLLVIKLLTNDKEVLVPFVKEIIPEIDIKNKFLIITPPPGLLEL

rimM

Ribosome maturation factor RimM

179 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.055 kDa

MMARDPDWLLVGQVVAAHGLRGWLRVRCWSDFPERFTEPGPRWLQRDTDPEPLLHPLIEGQFFPAKGLYLVRLEGIPNRTVAETWVGARLLVPASHRLPLQPEEYHYRDLIGLAVYHQGELLGQVSGILAAGQDVLEITTSDHRQVLIPFVKALVPVVDLEKGALHVQPPPGLVESFLG

rimM

Ribosome maturation factor RimM

179 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.732 kDa

MIKKEEVYKIGLFNKPHGIHGELQFTFTDDIFDRVDCDYLICLLDGIFVPFFIEEYRFRSDSTALVKLEGIDTAERARMFTNVEVYFPVKHAEEAEDGELSWNFFVGFRMEDVRHGELGEVVEVDTATVNTLFVVEQEDGEELLVPAQEEFIVEINQEKKLITVELPEGLLNLEDLEED

rimM

Ribosome maturation factor RimM

179 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

19.44 kDa

MEESATVEVVVGRVGRAHGLRGDVVVEVRTDEPDARFGVGATVQIEGSRRDLTVVRSRWAKGCLIVAFDEVKDRQGAEELRGSVLVVDVEPNDDPDDPDEFWDRRLRGLTVVDESGKSRGAVKDVLHMPAQDVLVIDVSGEEHLVPFVHQLVPTVDVASGRIVVSGIPGLLDSNAEEAR

rimM

Ribosome maturation factor RimM

179 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

21.209 kDa

MSEKDFVQVAKLGKTVGLKGYVKLHNLSDFSSQFKKDATFFIKNTKEMLKIKHYNASNSTVLFENYEDIEKAKELINLILFQSIEKSRQTCKLKKDEFFYFDILECEVFEEDKRLGKVIDILETGASYLFEIQSDEKWVEKKYPKIFFIPYLDKFVKNIDIEKRQIFCTQDAFLILENS

rimM

Ribosome maturation factor RimM

179 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

21.182 kDa

MSEKDFVQVAKLGKTVGLKGYVKLHNLSDFSSQFKKDATFFIKNTKEMLKIKHYNASNSTVLFENYEDIEKAKELTNLILFQSIEKSRQTCKLKKDEFFYFDILECEVFEEDKRLGKVVDILETGASYLFEIQSDEKWVEKKYPKIFFIPYLDKFVKNIDIEKRQIFCTQDAFLILENS

rimM

Ribosome maturation factor RimM

179 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

21.209 kDa

MSEKDFVQVAKLGKTVGLKGYVKLHNLSDFSSQFKKDATFFIKNTKEMLKIKHYNANNSTVLFENYEDIEKAKELTNLILFQSIEKSRQTCKLKKDEFFYFDILECEVFEEDKRLGKVVDILETGASYLFEIQSDEKWVEKKYPKIFFIPYLDKFVKNIDIEKRQIFCTQDAFLILENS

rimM

Ribosome maturation factor RimM

179 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

21.209 kDa

MSEKDFVQVAKLGKTVGLKGYVKLHNLSDFSSQFKKDATFFIKNTKEMLKIKHYNASNSTVLFENYEDIEKAKELINLILFQSIEKSRQTCKLKKDEFFYFDILECEVFEEDKRLGKVIDILETGASYLFEIQSDEKWVEKKYPKIFFIPYLDKFVKNIDIEKRQIFCTQDAFLILENS

rimM

Ribosome maturation factor RimM

179 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

21.151 kDa

MSEKDFVQVAKLGKTVGLKGYVKLHNLSDFSSQFKKDATFFIKNTKEMLKIKHYNANNSTVLFENYEDIEKAKELTNLILFQSIEKSRQTCKLKKDEFFYFDILECEVFEEDKRLGKVVDILETGASYLFEIQSDEKWVEKKYPKIFFIPYLGKFVKNIDIEKRQIFCTQDAFLILENS

rimM

Ribosome maturation factor RimM

179 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.89 kDa

MHPELDLVYVGKIVGTHGVKGELKVISLTDIENRFNELDRVYLVNEQDHYDPIIAHIESSFTHKNMEIVKFSEWDDINQVEGFHDWYIKIPREERPQLEEDEYYFDQITGLSVVTVEDEFLGTVTNIYQTGSNDVYEVSKEQDDKPILIPALYEVVKKIDLDEQIMIVDLPEGLLDEEE

rimM

Ribosome maturation factor RimM

179 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.306 kDa

MSKQSNKLLHIATIGKSVGLGGDMKLHIKSDFPEQFKKGVSFFINENETLTLSDINHERALIKFVGYNSPEDAKKLTNKNLYTTIERTRKECRLEKDEYFWFDIEGCSVVEDGKVLGIVDELDRMGITNYLCVITDETLVKSGFAKSFLIPFREPFTINTDIKEKIITVIGAMDILEAS

rimM

Ribosome maturation factor RimM

179 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.159 kDa

MNATPASADDLIVIGKIYSVHGVRGEVKVYSFTDPIGNLLDYKTWTLRREGSVEKQVELVSGRLQSKFLVVKLKGLDDREEARLLSGYEICVPRNLFPDLDDGEYYWYQLEGLKVIDQLGQLLGKIDHLLETGSNDVMVVKPCAGSLDDRERLLPYTEQCVLAIDMAAGEMKVEWDADF

rimM

Ribosome maturation factor RimM

179 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.133 kDa

MNATPASADDLIVIGKIYSVHGVRGEVKVYSFTDPIGNLLDYKTWTLRREGSVDKQVELVSGRLQSKFLVTKLKGLDDREEARLLSGYEICVPRNLFPDLDDGEYYWYQLEGLKVIDQLGQLLGKIDHLLETGSNDVMVVKPCAGSLDDRERLLPYTEQCVLAIDMAAGEMKVDWDADF

rimM

Ribosome maturation factor RimM

179 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

19.295 kDa

MHAHGALLELTIGRVVKAHGIGGEVVVEIRTDDPASRFCPGNILRAKDFPRGGPERRYTVVYAREHGARLLVRLAGVSDRDAADALRGSLFVIDSLDLPPIDEPDTYYDHQLEGLQVRTMMGRDVGVVAEVLHTAAGELLAVRCDSGEVLVPFVGAIVKLVSLDDGIVEIDPPKGLLDL

rimM

Ribosome maturation factor RimM

179 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

19.295 kDa

MHAHGALLELTIGRVVKAHGIGGEVVVEIRTDDPASRFCPGNILRAKDFPRGGPERRYTVVYAREHGARLLVRLAGVSDRDAADALRGSLFVIDSLDLPPIDEPDTYYDHQLEGLQVRTMMGRDVGVVAEVLHTAAGELLAVRCDSGEVLVPFVGAIVKLVSLDDGIVEIDPPKGLLDL

rimM

Ribosome maturation factor RimM

179 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

19.773 kDa

MKVPEDLVLVGYISGAYGLNGWVRVRPYSADADALLTAKTWWLDKPEFHDVEMMQSKIHTGDVVAKLMGVAGRDAAEALKGATVQIPRSHFPALSDNEFYWVDLIGLEVENLQGEHLGQVSDMMDNGAHPILRVAVPQAAETTDPKAAPQELLIPFVEQFVITVDRTAKKITVDWGLDY

rimM

Ribosome maturation factor RimM

178 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

19.977 kDa

MNATPEKADDLIVVGKIFSVHGVRGEVKVYSFTDPIENLLDYPRWTLRHEGKVKQVELVSGRGSQKGLVVKLKGLDDRDEARLLSGHEICISRSLLPNLATDEYYWYQLVGLKVINQDEHLFGKIDHLLETGANDVLVVKPCAGSLDDRERLLPYTGQCVLAVDLEAGVMRVEWDADF

rimM

Ribosome maturation factor RimM

178 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

19.85 kDa

MNATPAPADDLIVIGKIYSVHGVRGEVKVFSFTDPIKNLLDYKTWTLKREGSVKQVELVSGRGNDKFLVAKLKGLDDREEARLLAGYEICVPRSLFPELTDGEYYWYQLQGLKVIDGLGQLLGKIDHLLETGSNDVMVVKPCAGSLDDRERLLPYTEQCVLAVDLAAGEMKVEWDADF

rimM

Ribosome maturation factor RimM

178 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.017 kDa

MNATPAVADDLIVIGKIYSVHGVRGEVKVYSFTDPTENLLQYKTWTLKREGSVKQVELVSGRGSDKFLVAKLKGLDDREEARLLAGYEICVPRNLFPELTDGEYYWYQLEGLKVIDQLGQLFGKIDHLLETGANDVMVVKPCAGSLDDRERLLPYTKQCVLAVDLEAGEMKVEWDADF

rimM

Ribosome maturation factor RimM

178 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

19.947 kDa

MSQENTSSIIVVGKLGAPYGIKGWLKVHSFTDDPAGIFDFSPWLIGQQGKWQTLEVVDWRRHNKGFIAKFAQVNDRDEAVAYTHAEISMDSAQLPELPQGEFYWRDLIGMSVVTDKGYDLGIVDDLMETGSNDVLVVKANSKDAFGQAERLIPFLTDTVIIEVKHDAREITVDWDPGF

rimM

Ribosome maturation factor RimM

178 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

19.858 kDa

MSTTPAVAEDLIVLGKIVSVHGVRGEVKVYSFTDPIDNVLDYRHWTLRRDGEVKKVELASGRLQGKVLVAKLKGLDDREIARTYAGFEICVPRSELPDLEEGEFYWYQLQGLKVIDQAGQLLGVVDHLFETGANDVMVVKACAGSLDDRERLLPYTDQCVLSIDLAAGEMRVDWDADF

rimM

Ribosome maturation factor RimM

178 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.082 kDa

MNATPEKADDLIVVGKIFSVHGVRGEVKVYSFTDPIENLLDYPRWTLRHEGKVKQVELVSGRGSQKGLVVKLKGLDDRDEARLLSGYEICIPRSLLPNLAADEYYWYQLVGLKVINQDEQLFGKVDHMLETGANDVMVVKPCAGSLDDRERLLPYTEQCVLAIDLEAGVMRVEWDADF

rimM

Ribosome maturation factor RimM

178 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.

20.102 kDa

MSATPEKADDLIVVGKIFSVHGVRGEVKVFSFTDPIENLLGYRNWTLRREGVVKQVELVSGRSTQKDLVVKLKGLDDRDEARLLSGYEICIPRSLLPDLTADEYYWYQLEGLSVINQDEQLFGKVDHLLETGANDVLVVKPCVGSLDDRERLLPYTEQCVLAIDLEAGVMRVEWDADF

rimM

Ribosome maturation factor RimM

178 amino acids

An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Belongs to the RimM family.