About Products Protein Database Contact

Protein expression services for rimM | Ribosome maturation factor RimM

Description
An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.
Family
Belongs to the RimM family.
Species
Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
Length
179 amino acids
Sequence
MSEKDFVQVAKLGKTVGLKGYVKLHNLSDFSSQFKKDATFFIKNTKEMLKIKHYNASNSTVLFENYEDIEKAKELINLILFQSIEKSRQTCKLKKDEFFYFDILECEVFEEDKRLGKVIDILETGASYLFEIQSDEKWVEKKYPKIFFIPYLDKFVKNIDIEKRQIFCTQDAFLILENS
Mass
21.2 kDa
Simulated SDS-PAGE
Western blot of rimM recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make rimM using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here