Essential for efficient processing of 16S rRNA. Probably part of the 30S subunit prior to or during the final step in the processing of 16S free 30S ribosomal subunits. It could be some accessory protein needed for efficient assembly of the 30S subunit. It is needed in a step prior to RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes (By similarity).

Belongs to the RimM family.

246 amino acids

MKRKQESKGAGEKRQGAGGRGQGEKKQGKQGRQGRQGRQGEKSPVPSPQSPIPNPQFTTPNPDEWLQIGKIVSAQGLSGEVRVYPDSDFPERFEVPGTRWLLRPGQTEPQPIELLHGRYLENKNLYVLQLAGVENRSQSEELRGCMLFVPASDRPELGEDEYHVVDLIGMEVFLQASGDLVGAVVDVIPAGNDLLEVSLHEPVTSDKKPKTVLIPFVKAIAPVVDLQTRRIEITPPPGLLELGSGV

26.9 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make rimM using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here