ribU

Riboflavin transporter RibU

211 amino acids

Substrate-binding (S) component of an energy-coupling factor (ECF) ABC-transporter complex. Mediates riboflavin uptake, may also transport FMN and roseoflavin. Probably a riboflavin-binding protein that interacts with the energy-coupling factor (ECF) ABC-transporter complex. Unlike classic ABC transporters this ECF transporter provides the energy necessary to transport a number of different substrates. The substrates themselves are bound by transmembrane, not extracytoplasmic soluble proteins (Probable). Expression of the complex plus RibU in E.coli allows riboflavin uptake.

Belongs to the prokaryotic riboflavin transporter (P-RFT) (TC 2.A.87) family.

23.644 kDa

MRSLFFGIGKSIGNFFQIVKIWRNFFMTNTRKLAYIAILSAVSFLLLYFSFPLIPAADFLKVDFSILPVLIALVIFDFKSAIGVLLLRSLLKLLLNNGGPGSMIGLPMNFVALGVFVWGLSYFWKKNQTSKNYILGSVLGTILLTVAMVVLNYIYAVPLYAKFANFDIAQFIGLYKYLFAMVVPFNLLEGLIFSVAFALIYAPLKSILVKL

ribU

Riboflavin transporter RibU

206 amino acids

Mediates riboflavin uptake, may also transport FMN and roseoflavin (By similarity). Probably a riboflavin-binding protein that interacts with the energy-coupling factor (ECF) ABC-transporter complex. Unlike classic ABC transporters this ECF transporter provides the energy necessary to transport a number of different substrates. The substrates themselves are bound by transmembrane, not extracytoplasmic soluble proteins. Uptake of riboflavin into proteosomes containing EcfA1A2T and RibU has been demonstrated. Uptake requires hydrolyzable Mg-ATP.

Belongs to the prokaryotic riboflavin transporter (P-RFT) (TC 2.A.87) family.

22.972 kDa

MSKTRRMVLIAMLAALSTILLLPILQFPLLPGIDFMKVELSIIPVLIGVFTLGLGDGFIILFIRSVLWYLLFNQGPSTWIGVPMNFVALGIFMAIVWFFTKKKFSIKNYTVGIVLATIASVLVMMVLNVFYALPLYRLAAGFDVDKIFAGATHLFNMGSLSVTLNPTYLLTVVLPFNALQYIIFALVFGLIVTVFKKNKVVKFYNA

ribU

Riboflavin transporter RibU

206 amino acids

Probably a riboflavin-binding protein that interacts with the energy-coupling factor (ECF) ABC-transporter complex. Unlike classic ABC transporters this ECF transporter provides the energy necessary to transport a number of different substrates. The substrates themselves are bound by transmembrane, not extracytoplasmic soluble proteins (By similarity). Mediates riboflavin uptake, probably also transports FMN and roseoflavin.

Belongs to the prokaryotic riboflavin transporter (P-RFT) (TC 2.A.87) family.

22.972 kDa

MSKTRRMVLIAMLAALSTILLLPILQFPLLPGIDFMKVELSIIPVLIGVFTLGLGDGFIILFIRSVLWYLLFNQGPSTWIGVPMNFVALGIFMAIVWFFTKKKFSIKNYTVGIVLATIASVLVMMVLNVFYALPLYRLAAGFDVDKIFAGATHLFNMGSLSVTLNPTYLLTVVLPFNALQYIIFALVFGLIVTVFKKNKVVKFYNA

ribU

Riboflavin transporter RibU

196 amino acids

Probable riboflavin-binding protein that interacts with the energy-coupling factor (ECF) ABC-transporter complex. Unlike classic ABC transporters this ECF transporter provides the energy necessary to transport a number of different substrates. The substrates themselves are bound by transmembrane, not extracytoplasmic soluble proteins and transport it into cells (By similarity).

Belongs to the prokaryotic riboflavin transporter (P-RFT) (TC 2.A.87) family.

22.268 kDa

MSIIPVTRVQRTTLIAILSAISFGLMLFPQVPIIPSADFLKLDFSIVPVVIGLYWLNYSASLWVILIRTLLKLILANEGVNTYLGLPVNLLVVLAFITVLKITMPNLEQYSNWQKKILPLISSTFVMTIVAIVINWFVAIPLYARFANFDIAKFIGLKNYFIGMVLPFNLIEGIIWFVVSMIILRAIQPLQRRFHS

ribU

Riboflavin transporter RibU

189 amino acids

Mediates riboflavin uptake, may also transport FMN and roseoflavin. Probably a riboflavin-binding protein that interacts with the energy-coupling factor (ECF) ABC-transporter complex. Unlike classic ABC transporters this ECF transporter provides the energy necessary to transport a number of different substrates. The substrates themselves are bound by transmembrane, not extracytoplasmic soluble proteins (By similarity).

Belongs to the prokaryotic riboflavin transporter (P-RFT) (TC 2.A.87) family.

21.009 kDa

MNGRRKLNMQQNKRLITISMLSAIAFVLTFIKFPIPFLPPYLTLDFSDVPSLLATFTFGPVAGIIVALVKNLLNYLFSMGDPVGPFANFLAGASFLLTAYAIYKNKRSTKSLITGLIIATIVMTIVLSILNYFVLLPLYGMIFNLADIANNLKVIIVSGIIPFNIIKGIVISIVFILLYRRLANFLKRI

ribU

Riboflavin transporter RibU

183 amino acids

Substrate-binding (S) component of an energy-coupling factor (ECF) ABC-transporter complex. Mediates riboflavin uptake, may also transport FMN and roseoflavin. Probably a riboflavin-binding protein that interacts with the energy-coupling factor (ECF) ABC-transporter complex. Unlike classic ABC transporters this ECF transporter provides the energy necessary to transport a number of different substrates. The substrates themselves are bound by transmembrane, not extracytoplasmic soluble proteins (Probable). Expression of the complex plus RibU in E.coli allows riboflavin uptake; uptake does not occur in the absence of RibU or the EcfA1A2T complex.

Belongs to the prokaryotic riboflavin transporter (P-RFT) (TC 2.A.87) family.

20.015 kDa

MSSIKKISFVGIFSALATLVMFLEFPIFPQASFLKYDPSEIPALIVSFLLGPGVGMFVVLVKDILFFLMKSGDPVGIAMNAVLGMSFVGIAGLIYHRNKSRATAIKGMIVATLFATAFALGLNALIVPLYFEAPFELYLKFFPFILAFNLVKFGIDSVVTFFVYKKVSSILKLETVEGRSNNG