Probable riboflavin-binding protein that interacts with the energy-coupling factor (ECF) ABC-transporter complex. Unlike classic ABC transporters this ECF transporter provides the energy necessary to transport a number of different substrates. The substrates themselves are bound by transmembrane, not extracytoplasmic soluble proteins and transport it into cells (By similarity).

Belongs to the prokaryotic riboflavin transporter (P-RFT) (TC 2.A.87) family.

196 amino acids

MSIIPVTRVQRTTLIAILSAISFGLMLFPQVPIIPSADFLKLDFSIVPVVIGLYWLNYSASLWVILIRTLLKLILANEGVNTYLGLPVNLLVVLAFITVLKITMPNLEQYSNWQKKILPLISSTFVMTIVAIVINWFVAIPLYARFANFDIAKFIGLKNYFIGMVLPFNLIEGIIWFVVSMIILRAIQPLQRRFHS

22.3 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make ribU using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here