Description
Substrate-binding (S) component of an energy-coupling factor (ECF) ABC-transporter complex. Mediates riboflavin uptake, may also transport FMN and roseoflavin. Probably a riboflavin-binding protein that interacts with the energy-coupling factor (ECF) ABC-transporter complex. Unlike classic ABC transporters this ECF transporter provides the energy necessary to transport a number of different substrates. The substrates themselves are bound by transmembrane, not extracytoplasmic soluble proteins (Probable). Expression of the complex plus RibU in E.coli allows riboflavin uptake.
Family
Belongs to the prokaryotic riboflavin transporter (P-RFT) (TC 2.A.87) family.
Species
Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Sequence
MRSLFFGIGKSIGNFFQIVKIWRNFFMTNTRKLAYIAILSAVSFLLLYFSFPLIPAADFLKVDFSILPVLIALVIFDFKSAIGVLLLRSLLKLLLNNGGPGSMIGLPMNFVALGVFVWGLSYFWKKNQTSKNYILGSVLGTILLTVAMVVLNYIYAVPLYAKFANFDIAQFIGLYKYLFAMVVPFNLLEGLIFSVAFALIYAPLKSILVKL
Simulated SDS-PAGE

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service